JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
GSC

GSC

Description	Homeobox protein goosecoid

Gene and Protein Information

Gene ID	145258
Uniprot Accession IDs	Q86YR1
Ensembl ID	ENSP00000238558
Symbol	SAMS
Family	Belongs to the paired homeobox family. Bicoid subfamily.
Sequence	MPASMFSIDNILAARPRCKDSVLPVAHSAAAPVVFPALHGDSLYGASGGASSDYGAFYPRPVAPGGAGLPAAVSGSRLGYNNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	467546	GSC	goosecoid homeobox	9598	VGNC:3412	Inparanoid, OMA, EggNOG
Mouse	14836	Gsc	goosecoid homeobox	10090	MGI:95841	Inparanoid, OMA, EggNOG
Rat	317715	Gsc	goosecoid homeobox	10116	RGD:631425	Inparanoid, OMA, EggNOG
Dog	100683589	GSC	goosecoid homeobox	9615	VGNC:41525	Inparanoid, OMA, EggNOG
Cow	514862	GSC	goosecoid homeobox	9913	VGNC:29672	Inparanoid, OMA, EggNOG
Pig	397342	GSC	goosecoid homeobox	9823		OMA, EggNOG
Opossum	100019312	GSC	goosecoid homeobox	13616		Inparanoid, EggNOG
Chicken	396273	GSC	goosecoid homeobox	9031	CGNC:8338	Inparanoid, OMA, EggNOG
Anole lizard		GSC	goosecoid homeobox [Source:HGNC Symbol;Acc:HGNC:4612]	28377		Inparanoid, OMA, EggNOG
Xenopus	549458	gsc	goosecoid homeobox	8364	XB-GENE-486771	Inparanoid, OMA, EggNOG
Zebrafish	30212	gsc	goosecoid	7955	ZDB-GENE-980528-2060	Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]