Protein or Target Summary
Glycogen synthase kinase-3 beta
| Gene ID | 2932 |
|---|---|
| uniprot | P49841 |
| Gene Name | GSK3B |
| Ensernbl ID | ENSP00000324806 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. GSK-3 subfamily. |
| Sequence | MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 2932 | GSK3B | Glycogen synthase kinase-3 beta | P49841 |
| MOUSE | 56637 | Gsk3b | Glycogen synthase kinase-3 beta | E9QAQ5 |
| MOUSE | Gsk3b | Glycogen synthase kinase-3 beta | A0A338P6P8 | |
| MOUSE | Gsk3b | Uncharacterized protein | Q3TB31 | |
| MOUSE | 56637 | Gsk3b | Glycogen synthase kinase 3 beta | Q5KU03 |
| MOUSE | 56637 | Gsk3b | Glycogen synthase kinase-3 beta | Q9WV60 |
| RAT | 84027 | Gsk3b | Glycogen synthase kinase-3 beta | A0A0G2KB98 |
| RAT | 84027 | Gsk3b | Glycogen synthase kinase 3 beta, isoform CRA_b | A0A0G2JSH4 |
| RAT | 84027 | Gsk3b | Glycogen synthase kinase-3 beta | P18266 |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Glycogen synthase kinase-3 beta
protein / protein kinase / Glycogen synthase kinase-3 beta
protein / transferase / Glycogen synthase kinase-3 beta
protein / kinase / Glycogen synthase kinase-3 beta
protein / non-receptor serine/threonine protein kinase / Glycogen synthase kinase-3 beta
protein / protein kinase / Glycogen synthase kinase-3 beta
protein / transferase / Glycogen synthase kinase-3 beta
protein / kinase / Glycogen synthase kinase-3 beta
DTO Classes
protein / Kinase / Protein kinase / CMGC group / GSK family / GSK subfamily / Glycogen synthase kinase-3 beta
protein / Kinase / Protein kinase / CMGC group / GSK family / GSK subfamily / Glycogen synthase kinase-3 beta
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx