The store will not work correctly when cookies are disabled.
EPCAM
| Description | Epithelial cell adhesion molecule |
|---|
Gene and Protein Information
| Gene ID | 4072 |
|---|
| Uniprot Accession IDs | P18180 Q6FG26 Q6FG49 Q96C47 Q9UCD0 Ep-CAM |
|---|
| Ensembl ID | ENSP00000263735 |
|---|
| Symbol | GA733-2 M1S2 M4S1 MIC18 TACSTD1 TROP1 ESA KSA M4S1 MK-1 DIAR5 EGP-2 EGP40 KS1/4 MIC18 TROP1 EGP314 HNPCC8 TACSTD1 |
|---|
| Family | Belongs to the EPCAM family. |
|---|
| Sequence | MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 459214 | EPCAM | epithelial cell adhesion molecule | 9598 | VGNC:245 | OMA, EggNOG |
| Macaque | 677680 | EPCAM | epithelial cell adhesion molecule | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 17075 | Epcam | epithelial cell adhesion molecule | 10090 | MGI:106653 | Inparanoid, OMA, EggNOG |
| Rat | 171577 | Epcam | epithelial cell adhesion molecule | 10116 | RGD:621365 | Inparanoid, OMA, EggNOG |
| Dog | 481360 | EPCAM | epithelial cell adhesion molecule | 9615 | VGNC:54146 | Inparanoid, OMA, EggNOG |
| Horse | 100053148 | EPCAM | epithelial cell adhesion molecule | 9796 | VGNC:17614 | Inparanoid, OMA, EggNOG |
| Cow | 514039 | EPCAM | epithelial cell adhesion molecule | 9913 | VGNC:28529 | Inparanoid, OMA, EggNOG |
| Pig | 403163 | EPCAM | epithelial cell adhesion molecule | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100033359 | EPCAM | epithelial cell adhesion molecule | 13616 | | Inparanoid, EggNOG |
| Chicken | 421292 | EPCAM | epithelial cell adhesion molecule | 9031 | CGNC:6812 | Inparanoid, OMA |
| Xenopus | 496567 | epcam | epithelial cell adhesion molecule | 8364 | XB-GENE-986667 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
