Click Here for 5% Off Your First Aladdin Purchase!
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

Protein or Target Summary

Glutathione S-transferase theta-2

Gene ID2953
uniprotP0CG29
Gene NameGSTT2
Ensernbl ID
FamilyBelongs to the GST superfamily. Theta family.
Sequence
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN2953GSTT2Glutathione S-transferase theta-2P0CG29
MOUSEGstt2Glutathione S-transferase theta-2A0A1W2P7J9
MOUSEGstt2Glutathione S-transferase theta-2A0A1W2P6L1
MOUSE14872Gstt2Glutathione S-transferase theta-2Q61133
RAT29487Gstt2Glutathione S-transferase theta 2B6DYQ9
RAT29487Gstt2Glutathione S-transferase theta-2P30713

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Source: DataSourcesLicenses.xlsx
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.