The store will not work correctly when cookies are disabled.
GSTT2
| Description | Glutathione S-transferase theta-2 |
|---|
Gene and Protein Information
| Gene ID | 2953 |
|---|
| Uniprot Accession IDs | O60665 P30712 Q6IPV7 Q9HD76 |
|---|
| Family | Belongs to the GST superfamily. Theta family. |
|---|
| Sequence | MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 700185 | GSTT2 | glutathione S-transferase theta 2 | 9544 | | Inparanoid, OMA |
| Mouse | 14872 | Gstt2 | glutathione S-transferase, theta 2 | 10090 | MGI:106188 | Inparanoid, OMA |
| Rat | 29487 | Gstt2 | glutathione S-transferase, theta 2 | 10116 | RGD:69362 | Inparanoid, OMA |
| Dog | 100686488 | LOC100686488 | glutathione S-transferase theta-2B-like | 9615 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
