The store will not work correctly when cookies are disabled.
KCTD8
| Description | BTB/POZ domain-containing protein KCTD8 |
|---|
Gene and Protein Information
| Gene ID | 386617 |
|---|
| Uniprot Accession IDs | A2RU39 |
|---|
| Ensembl ID | ENSP00000353129 |
|---|
| Sequence | MALKDTGSGGSTILPISEMVSSSSSPGASAAAAPGPCAPSPFPEVVELNVGGQVYVTKHSTLLSVPDSTLASMFSPSSPRGGARRRGELPRDSRARFFIDRDGFLFRYVLDYLRDKQLALPEHFPEKERLLREAEYFQLTDLVKLLSPKVTKQNSLNDEGCQSDLEDNVSQGSSDALLLRGAAAAVPSGPGAHGGGGGGGAQDKRSGFLTLGYRGSYTTVRDNQADAKFRRVARIMVCGRIALAKEVFGDTLNESRDPDRQPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSSGTAAFVNQYRDDKIWSSYTEYIFFRPPQKIVSPKQEHEDRKHDKVTDKGSESGTSCNELSTSSCDSHSEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSKKKVCEKLSVEEEMKKCIQDFKKIHIPDYFPERKRQWQSELLQKYGL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 461195 | KCTD8 | potassium channel tetramerization domain containing 8 | 9598 | VGNC:13099 | OMA, EggNOG |
| Macaque | 703107 | KCTD8 | potassium channel tetramerization domain containing 8 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 243043 | Kctd8 | potassium channel tetramerisation domain containing 8 | 10090 | MGI:2443804 | Inparanoid, OMA, EggNOG |
| Dog | 610705 | KCTD8 | potassium channel tetramerization domain containing 8 | 9615 | VGNC:42311 | Inparanoid, OMA |
| Opossum | | KCTD8 | potassium channel tetramerization domain containing 8 [Source:HGNC Symbol;Acc:HGNC:22394] | 13616 | | Inparanoid, OMA |
| Chicken | 770600 | KCTD8 | potassium channel tetramerization domain containing 8 | 9031 | CGNC:10600 | Inparanoid, OMA |
| Anole lizard | 100562362 | kctd8 | potassium channel tetramerization domain containing 8 | 28377 | | Inparanoid, OMA |
Protein Classes
PANTHER Classes protein /
enzyme modulator / BTB/POZ domain-containing protein KCTD8
DTO Classes protein /
Enzyme modulator / BTB/POZ domain-containing protein KCTD8
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
