JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Histone H1.0

Gene ID	3005
uniprot	P07305
Gene Name	H1F0
Ensernbl ID	ENSP00000344504
Family	Belongs to the histone H1/H5 family.
Sequence	MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	3005	H1F0	Histone H1.0	P07305
MOUSE		H1f0	Uncharacterized protein	Q8C1Y3
MOUSE		H1f0	Uncharacterized protein	Q3U5Y1
MOUSE		H1f0	Uncharacterized protein	Q3U4Y0
MOUSE	14958	H1f0	Histone H1.0	P10922
RAT	24437	H1f0	Histone H1.0	P43278

Protein Classes

PANTHER Classes
protein / nucleic acid binding / histone / Histone H1.0

DTO Classes
protein / Nucleic acid binding / DNA binding protein / Histone / Histone H1.0

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx