The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 3005 |
|---|
| Uniprot Accession IDs | B2R6I0 B4DRD6 Q6FG88 Q8N6R3 |
|---|
| Ensembl ID | ENSP00000344504 |
|---|
| Symbol | H1FV H10 H1FV |
|---|
| Family | Belongs to the histone H1/H5 family. |
|---|
| Sequence | MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 743278 | H1F0 | H1 histone family member 0 | 9598 | VGNC:14352 | OMA, EggNOG |
| Mouse | 14958 | H1f0 | H1 histone family, member 0 | 10090 | MGI:95893 | Inparanoid, OMA, EggNOG |
| Cow | 617975 | H1F0 | H1 histone family, member 0 | 9913 | | Inparanoid, OMA, EggNOG |
| Xenopus | 407939 | h1f0 | H1 histone family member 0 | 8364 | XB-GENE-480028 | Inparanoid, OMA, EggNOG |
| Zebrafish | 321618 | h1f0 | H1 histone family, member 0 | 7955 | ZDB-GENE-030131-337 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
