The store will not work correctly when cookies are disabled.
GSTM5
| Description | Glutathione S-transferase Mu 5 |
|---|
Gene and Protein Information
| Gene ID | 2949 |
|---|
| Uniprot Accession IDs | A8K0V8 Q6PD78 |
|---|
| Ensembl ID | ENSP00000256593 |
|---|
| Symbol | GTM5 GSTM5-5 |
|---|
| Family | Belongs to the GST superfamily. Mu family. |
|---|
| Sequence | MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 745685 | GSTM5 | glutathione S-transferase mu 5 | 9598 | VGNC:6852 | OMA, EggNOG |
| Anole lizard | 100554103 | LOC100554103 | glutathione S-transferase Mu 1 | 28377 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
