| Description | Histone deacetylase 3 |
|---|
Gene and Protein Information
| Gene ID | 8841 |
|---|---|
| Uniprot Accession IDs | D3DQE1 O43268 Q9UEI5 Q9UEV0 HD3 |
| Ensembl ID | ENSP00000302967 |
| Symbol | HD3 RPD3 KDAC3 RPD3-2 |
| Family | Belongs to the histone deacetylase family. HD type 1 subfamily. |
| Sequence | MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 738624 | HDAC3 | histone deacetylase 3 | 9598 | VGNC:4032 | OMA, EggNOG |
| Macaque | 704467 | HDAC3 | histone deacetylase 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 15183 | Hdac3 | histone deacetylase 3 | 10090 | MGI:1343091 | Inparanoid, OMA, EggNOG |
| Rat | 84578 | Hdac3 | histone deacetylase 3 | 10116 | RGD:619977 | Inparanoid, OMA |
| Dog | 478040 | HDAC3 | histone deacetylase 3 | 9615 | VGNC:50628 | Inparanoid, OMA, EggNOG |
| Horse | 100061405 | HDAC3 | histone deacetylase 3 | 9796 | VGNC:49121 | Inparanoid, OMA, EggNOG |
| Pig | 100511372 | HDAC3 | histone deacetylase 3 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100022921 | HDAC3 | histone deacetylase 3 | 13616 | Inparanoid, EggNOG | |
| Chicken | 395506 | HDAC3 | histone deacetylase 3 | 9031 | CGNC:1896 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100557493 | hdac3 | histone deacetylase 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549637 | hdac3 | histone deacetylase 3 | 8364 | XB-GENE-481106 | Inparanoid, OMA, EggNOG |
| Zebrafish | 393965 | hdac3 | histone deacetylase 3 | 7955 | ZDB-GENE-040426-847 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / hydrolase / reductase / Histone deacetylase 3
protein / hydrolase / deacetylase / Histone deacetylase 3
protein / hydrolase / nucleic acid binding / Histone deacetylase 3
protein / hydrolase / reductase / Histone deacetylase 3
protein / hydrolase / deacetylase / Histone deacetylase 3
protein / hydrolase / nucleic acid binding / Histone deacetylase 3
DTO Classes
protein / Epigenetic regulator / Eraser / Histone deacetylase / HDAC class I / Histone deacetylase 3
protein / Epigenetic regulator / Eraser / Histone deacetylase / HDAC class I / Histone deacetylase 3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|