Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
྾

HDAC3

DescriptionHistone deacetylase 3

Gene and Protein Information

Gene ID8841
Uniprot Accession IDs O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 HD3
Ensembl ID ENSP00000302967
Symbol HD3 RPD3 KDAC3 RPD3-2
FamilyBelongs to the histone deacetylase family. HD type 1 subfamily.
Sequence
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp738624HDAC3histone deacetylase 39598VGNC:4032OMA, EggNOG
Macaque704467HDAC3histone deacetylase 39544Inparanoid, OMA, EggNOG
Mouse15183Hdac3histone deacetylase 310090MGI:1343091Inparanoid, OMA, EggNOG
Rat84578Hdac3histone deacetylase 310116RGD:619977Inparanoid, OMA
Dog478040HDAC3histone deacetylase 39615VGNC:50628Inparanoid, OMA, EggNOG
Horse100061405HDAC3histone deacetylase 39796VGNC:49121Inparanoid, OMA, EggNOG
Pig100511372HDAC3histone deacetylase 39823Inparanoid, OMA, EggNOG
Opossum100022921HDAC3histone deacetylase 313616Inparanoid, EggNOG
Chicken395506HDAC3histone deacetylase 39031CGNC:1896Inparanoid, OMA, EggNOG
Anole lizard100557493hdac3histone deacetylase 328377Inparanoid, OMA, EggNOG
Xenopus549637hdac3histone deacetylase 38364XB-GENE-481106Inparanoid, OMA, EggNOG
Zebrafish393965hdac3histone deacetylase 37955ZDB-GENE-040426-847Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    reductase    /    Histone deacetylase 3
protein    /    hydrolase    /    deacetylase    /    Histone deacetylase 3
protein    /    hydrolase    /    nucleic acid binding    /    Histone deacetylase 3
DTO Classes
protein    /    Epigenetic regulator    /    Eraser    /    Histone deacetylase    /    HDAC class I    /    Histone deacetylase 3

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      malignant mesothelioma3244Expression AtlasMONDO:0006292
      Heart Diseases44CTDMONDO:0005267
      Heart Diseases44DisGeNETMONDO:0005267
      Schizophrenia1087DisGeNETMONDO:0005090
      Peripheral T-cell lymphoma0DrugCentral Indication
      Primary cutaneous T-cell lymphoma0DrugCentral Indication
      Primary cutaneous T-cell lymphoma0DrugCentral Indication
      Multiple myeloma0DrugCentral Indication
      Primary cutaneous T-cell lymphoma0DrugCentral Indication
      Peripheral T-cell lymphoma0DrugCentral Indication

      Bibliography

      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.