Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

GCG

DescriptionGlucagon

Gene and Protein Information

Gene ID2641
Uniprot Accession IDs P01275 A6NN65 Q53TP6
Ensembl ID ENSP00000387662
Symbol GLP1 GLP2 GRPP GLP-1
FamilyBelongs to the glucagon family.
Sequence
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp100609153GCGglucagon9598VGNC:439OMA, EggNOG
Mouse14526Gcgglucagon10090MGI:95674Inparanoid, OMA, EggNOG
Rat24952Gcgglucagon10116RGD:2668Inparanoid, OMA, EggNOG
Dog403571GCGglucagon9615VGNC:41143Inparanoid, OMA, EggNOG
Horse100051551GCGglucagon9796VGNC:18274Inparanoid, OMA, EggNOG
Cow280802GCGglucagon9913VGNC:29284Inparanoid, OMA, EggNOG
Pig397595GCGglucagon9823Inparanoid, OMA, EggNOG
Opossum100015836GCGglucagon13616Inparanoid, OMA, EggNOG
Chicken396196GCGglucagon9031CGNC:8432Inparanoid, OMA
Xenopus448760gcgglucagon8364XB-GENE-1000156Inparanoid, OMA, EggNOG
Zebrafish494052gcgaglucagon a7955ZDB-GENE-010219-1Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details
Recombinant GCG AntibodyHuman,Mouse,Rat
  • IHC
Out of Stock
Expand

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      active Crohn's disease1059Expression AtlasMONDO:0005011
      colon cancer1587Expression AtlasMONDO:0021063
      intraductal papillary-mucinous adenoma (IPMA)2987Expression AtlasMONDO:0004381
      intraductal papillary-mucinous carcinoma (IPMC)3017Expression AtlasMONDO:0004285
      Aberrant Crypt Foci0CTD
      Anorexia0CTD
      Bradycardia0CTD
      Catalepsy0CTD
      Colitis24CTDMONDO:0005292
      Colonic Neoplasms1587CTDMONDO:0021063

      Bibliography

      1. and Drucker DJ. 1999-05 Glucagon-like Peptide 2. [PMID:10322410]
      2.Kieffer, T J TJ and Habener, J F JF. 1999-12 The glucagon-like peptides. [PMID:10605628]
      3.Huypens, P P, Ling, Z Z, Pipeleers, D D and Schuit, F F. 2000-08 Glucagon receptors on human islet cells contribute to glucose competence of insulin release. [PMID:10990079]
      4.Xiao, Q Q, Jeng, W W and Wheeler, M B MB. 2000-12 Characterization of glucagon-like peptide-1 receptor-binding determinants. [PMID:11116211]
      5.Bertenshaw, G P GP and 7 more authors. 2001-04-20 Marked differences between metalloproteases meprin A and B in substrate and peptide bond specificity. [PMID:11278902]
      6.Friis-Hansen, L L, Lacourse, K A KA, Samuelson, L C LC and Holst, J J JJ. 2001-06 Attenuated processing of proglucagon and glucagon-like peptide-1 in carboxypeptidase E-deficient mice. [PMID:11375130]
      7.Thulesen, Jesper J and 8 more authors. 2002-01-15 The truncated metabolite GLP-2 (3-33) interacts with the GLP-2 receptor as a partial agonist. [PMID:11738243]
      8.Chang, Xiaoqing X, Keller, Danielle D, O'Donoghue, Seán I SI and Led, Jens J JJ. 2002-03-27 NMR studies of the aggregation of glucagon-like peptide-1: formation of a symmetric helical dimer. [PMID:11943215]
      9.Thomsen, J J, Kristiansen, K K, Brunfeldt, K K and Sundby, F F. 1972-04-01 The amino acid sequence of human glucagon. [PMID:11946536]
      10.Shiota, Debora D, Kasamatsu, Teresa T, Dib, Sergio A SA, Chacra, Antonio R AR and Moisés, Regina S RS. 2002-05 Role of the Gly40Ser mutation in the glucagon receptor gene in Brazilian patients with type 2 diabetes mellitus. [PMID:11961492]