Protein or Target Summary
Polypeptide N-acetylgalactosaminyltransferase 2
| Gene ID | 2590 |
|---|---|
| uniprot | Q10471 |
| Gene Name | GALNT2 |
| Ensernbl ID | ENSP00000355632 |
| Family | Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily. |
| Sequence | MRRRSRMLLCFAFLWVLGIAYYMYSGGGSALAGGAGGGAGRKEDWNEIDPIKKKDLHHSNGEEKAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 2590 | GALNT2 | Polypeptide N-acetylgalactosaminyltransferase 2 | Q10471 |
| MOUSE | 108148 | Galnt2 | Polypeptide N-acetylgalactosaminyltransferase 2 | Q6PB93 |
| RAT | 292090 | Galnt2 | Polypeptide N-acetylgalactosaminyltransferase | D3ZFD2 |
| RAT | Galnt2 | Polypeptide N-acetylgalactosaminyltransferase | B5DF50 | |
| RAT | Galnt2 | Polypeptide N-acetylgalactosaminyltransferase | A0A0G2JU25 |
Protein Classes
PANTHER Classes
protein / transferase / glycosyltransferase / Polypeptide N-acetylgalactosaminyltransferase 2
protein / transferase / glycosyltransferase / Polypeptide N-acetylgalactosaminyltransferase 2
DTO Classes
protein / Enzyme / Transferase / Glycosyltransferase / Polypeptide N-acetylgalactosaminyltransferase 2
protein / Enzyme / Transferase / Glycosyltransferase / Polypeptide N-acetylgalactosaminyltransferase 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx