INMT

Description	Indolethylamine N-methyltransferase

Gene and Protein Information

Gene ID	11185
Uniprot Accession IDs	B8ZZ69 Q3KP49 Q9P1Y2 Q9UBY4 Q9UHQ0 Indolamine N-methyltransferase
Ensembl ID	ENSP00000013222
Symbol	TEMT
Family	Belongs to the class I-like SAM-binding methyltransferase superfamily. NNMT/PNMT/TEMT family.
Sequence	MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCFIVARKKPGP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	463912	INMT	indolethylamine N-methyltransferase	9598		OMA, EggNOG
Mouse	21743	Inmt	indolethylamine N-methyltransferase	10090	MGI:102963	Inparanoid, OMA, EggNOG
Rat	368066	Inmt	indolethylamine N-methyltransferase	10116	RGD:1597087	Inparanoid, OMA, EggNOG
Horse	100055070	INMT	indolethylamine N-methyltransferase	9796		Inparanoid, OMA, EggNOG
Cow	527922	INMT	indolethylamine N-methyltransferase	9913		Inparanoid, EggNOG
Xenopus	100145174	loc100145174	uncharacterized LOC100145174	8364	XB-GENE-5789558	OMA, EggNOG
Xenopus	548447	MGC107884	MGC107884 protein	8364	XB-GENE-5767840	Inparanoid, OMA

PANTHER Classes
protein / transferase / methyltransferase / Indolethylamine N-methyltransferase

DTO Classes
protein / Enzyme / Transferase / Methyltransferase / Indolethylamine N-methyltransferase

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source