The store will not work correctly when cookies are disabled.
INMT
| Description | Indolethylamine N-methyltransferase |
|---|
Gene and Protein Information
| Gene ID | 11185 |
|---|
| Uniprot Accession IDs | B8ZZ69 Q3KP49 Q9P1Y2 Q9UBY4 Q9UHQ0 Indolamine N-methyltransferase |
|---|
| Ensembl ID | ENSP00000013222 |
|---|
| Symbol | TEMT |
|---|
| Family | Belongs to the class I-like SAM-binding methyltransferase superfamily. NNMT/PNMT/TEMT family. |
|---|
| Sequence | MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCFIVARKKPGP |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 463912 | INMT | indolethylamine N-methyltransferase | 9598 | | OMA, EggNOG |
| Mouse | 21743 | Inmt | indolethylamine N-methyltransferase | 10090 | MGI:102963 | Inparanoid, OMA, EggNOG |
| Rat | 368066 | Inmt | indolethylamine N-methyltransferase | 10116 | RGD:1597087 | Inparanoid, OMA, EggNOG |
| Horse | 100055070 | INMT | indolethylamine N-methyltransferase | 9796 | | Inparanoid, OMA, EggNOG |
| Cow | 527922 | INMT | indolethylamine N-methyltransferase | 9913 | | Inparanoid, EggNOG |
| Xenopus | 100145174 | loc100145174 | uncharacterized LOC100145174 | 8364 | XB-GENE-5789558 | OMA, EggNOG |
| Xenopus | 548447 | MGC107884 | MGC107884 protein | 8364 | XB-GENE-5767840 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
