The store will not work correctly when cookies are disabled.
GOPC
| Description | Golgi-associated PDZ and coiled-coil motif-containing protein |
|---|
Gene and Protein Information
| Gene ID | 57120 |
|---|
| Uniprot Accession IDs | A6NM30 Q59FS4 Q969U8 |
|---|
| Ensembl ID | ENSP00000357484 |
|---|
| Symbol | CAL FIG CAL FIG PIST GOPC1 dJ94G16.2 |
|---|
| Sequence | MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 462964 | GOPC | golgi associated PDZ and coiled-coil motif containing | 9598 | VGNC:11085 | OMA, EggNOG |
| Mouse | 94221 | Gopc | golgi associated PDZ and coiled-coil motif containing | 10090 | MGI:2149946 | Inparanoid, OMA, EggNOG |
| Rat | 309774 | Gopc | golgi associated PDZ and coiled-coil motif containing | 10116 | RGD:1309512 | Inparanoid, OMA |
| Dog | 484100 | GOPC | golgi associated PDZ and coiled-coil motif containing | 9615 | VGNC:49713 | Inparanoid, OMA, EggNOG |
| Cow | 541186 | GOPC | golgi associated PDZ and coiled-coil motif containing | 9913 | VGNC:53793 | Inparanoid, OMA, EggNOG |
| Pig | 100520524 | GOPC | golgi associated PDZ and coiled-coil motif containing | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100030077 | GOPC | golgi associated PDZ and coiled-coil motif containing | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 770364 | GOPC | golgi associated PDZ and coiled-coil motif containing | 9031 | CGNC:11060 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100553890 | gopc | golgi associated PDZ and coiled-coil motif containing | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100145196 | gopc | golgi-associated PDZ and coiled-coil motif containing | 8364 | XB-GENE-5857191 | Inparanoid, OMA, EggNOG |
| Zebrafish | 326887 | gopc | golgi-associated PDZ and coiled-coil motif containing | 7955 | ZDB-GENE-030131-5086 | Inparanoid, OMA, EggNOG |
| C. elegans | 3565651 | gopc-1 | GOlgi-associated PDZ and Coiled-coil motif protein | 6239 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
