JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Golgi-associated PDZ and coiled-coil motif-containing protein

Gene ID	57120
uniprot	Q9HD26
Gene Name	GOPC
Ensernbl ID	ENSP00000357484
Sequence	MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	57120	GOPC	Golgi-associated PDZ and coiled-coil motif-containing protein	Q9HD26
MOUSE		Gopc	Gopc protein	Q8R025
MOUSE		Gopc	Uncharacterized protein	Q3TAF1
MOUSE		Gopc	Golgi-associated PDZ and coiled-coil motif-containing protein	K3W4Q9
MOUSE		Gopc	Golgi-associated PDZ and coiled-coil motif-containing protein	A0A1W2P7A5
MOUSE		Gopc	Golgi-associated PDZ and coiled-coil motif-containing protein	A0A1W2P7V0
MOUSE	94221	Gopc	Golgi-associated PDZ and coiled-coil motif-containing protein	Q8BH60
RAT	309774	Gopc	Golgi associated PDZ and coiled-coil motif containing (Predicted)	B4F775

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx