The store will not work correctly when cookies are disabled.
INHA
| Description | Inhibin alpha chain |
|---|
Gene and Protein Information
| Gene ID | 3623 |
|---|
| Uniprot Accession IDs | A8K8H5 |
|---|
| Ensembl ID | ENSP00000243786 |
|---|
| Family | Belongs to the TGF-beta family. |
|---|
| Sequence | MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 743866 | INHA | inhibin subunit alpha | 9598 | VGNC:1976 | OMA, EggNOG |
| Macaque | 574379 | INHA | inhibin alpha subunit | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 16322 | Inha | inhibin alpha | 10090 | MGI:96569 | Inparanoid, OMA, EggNOG |
| Rat | 24504 | Inha | inhibin alpha subunit | 10116 | RGD:2912 | Inparanoid, OMA, EggNOG |
| Dog | 488540 | INHA | inhibin subunit alpha | 9615 | VGNC:42020 | Inparanoid, OMA, EggNOG |
| Horse | 100034077 | INHA | inhibin alpha | 9796 | | Inparanoid, EggNOG |
| Cow | 281254 | INHA | inhibin subunit alpha | 9913 | VGNC:30199 | Inparanoid, OMA, EggNOG |
| Pig | 397386 | INHA | inhibin alpha subunit | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100009806 | INHA | inhibin alpha subunit | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 424197 | INHA | inhibin alpha subunit | 9031 | CGNC:8534 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100561289 | inha | inhibin alpha subunit | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 613114 | inha | inhibin subunit alpha | 8364 | XB-GENE-853910 | Inparanoid, OMA, EggNOG |
| Zebrafish | 570520 | inha | inhibin subunit alpha | 7955 | ZDB-GENE-060503-554 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
