Protein or Target Summary
Potassium channel subfamily K member 9
Gene ID | 51305 |
---|---|
uniprot | Q9NPC2 |
Gene Name | KCNK9 |
Ensernbl ID | ENSP00000430676 |
Family | Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. |
Sequence | MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV Show more |
Gene and Protein Information
Protein Classes
DTO Classes
protein / Ion channel / Two pore domain potassium channel family / Potassium channel subfamily K member 9
protein / Ion channel / Two pore domain potassium channel family / Potassium channel subfamily K member 9
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx