Protein or Target Summary
Potassium channel subfamily K member 9
| Gene ID | 51305 |
|---|---|
| uniprot | Q9NPC2 |
| Gene Name | KCNK9 |
| Ensernbl ID | ENSP00000430676 |
| Family | Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. |
| Sequence | MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV Show more |
Gene and Protein Information
Protein Classes
DTO Classes
protein / Ion channel / Two pore domain potassium channel family / Potassium channel subfamily K member 9
protein / Ion channel / Two pore domain potassium channel family / Potassium channel subfamily K member 9
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx