The store will not work correctly when cookies are disabled.
KCNK9
| Description | Potassium channel subfamily K member 9 |
|---|
Gene and Protein Information
| Gene ID | 51305 |
|---|
| Uniprot Accession IDs | Q2M290 Q540F2 |
|---|
| Ensembl ID | ENSP00000430676 |
|---|
| Symbol | TASK3 KT3.2 TASK3 K2p9.1 TASK-3 |
|---|
| Family | Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. |
|---|
| Sequence | MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 100425983 | KCNK9 | potassium two pore domain channel subfamily K member 9 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 223604 | Kcnk9 | potassium channel, subfamily K, member 9 | 10090 | MGI:3521816 | Inparanoid, OMA, EggNOG |
| Rat | 84429 | Kcnk9 | potassium two pore domain channel subfamily K member 9 | 10116 | RGD:621451 | Inparanoid, OMA, EggNOG |
| Dog | 482057 | KCNK9 | potassium two pore domain channel subfamily K member 9 | 9615 | VGNC:42280 | Inparanoid, OMA |
| Horse | 100058202 | KCNK9 | potassium two pore domain channel subfamily K member 9 | 9796 | VGNC:19302 | Inparanoid, OMA |
| Cow | 539586 | KCNK9 | potassium two pore domain channel subfamily K member 9 | 9913 | VGNC:30478 | Inparanoid, OMA |
| Opossum | 100027125 | KCNK9 | potassium two pore domain channel subfamily K member 9 | 13616 | | Inparanoid, OMA |
| Anole lizard | 100555658 | kcnk9 | potassium two pore domain channel subfamily K member 9 | 28377 | | Inparanoid, OMA |
| Zebrafish | 799704 | kcnk9 | potassium channel, subfamily K, member 9 | 7955 | ZDB-GENE-070705-260 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
