JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

KCNK13

Description	Potassium channel subfamily K member 13

Gene and Protein Information

Gene ID	56659
Uniprot Accession IDs	B5TJL8 Q96E79
Ensembl ID	ENSP00000282146
Symbol	THIK1 THIK-1 K2p13.1
Family	Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
Sequence	MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	737631	KCNK13	potassium two pore domain channel subfamily K member 13	9598	VGNC:7445	OMA, EggNOG
Macaque		KCNK13	potassium two pore domain channel subfamily K member 13 [Source:HGNC Symbol;Acc:HGNC:6275]	9544		Inparanoid, OMA, EggNOG
Mouse	217826	Kcnk13	potassium channel, subfamily K, member 13	10090	MGI:2384976	Inparanoid, OMA, EggNOG
Rat	64120	Kcnk13	potassium two pore domain channel subfamily K member 13	10116	RGD:68941	Inparanoid, OMA, EggNOG
Dog	490829	KCNK13	potassium two pore domain channel subfamily K member 13	9615	VGNC:53499	Inparanoid, OMA
Horse		KCNK13	potassium two pore domain channel subfamily K member 13 [Source:HGNC Symbol;Acc:HGNC:6275]	9796		OMA, EggNOG
Pig	100623906	KCNK13	potassium two pore domain channel subfamily K member 13	9823		Inparanoid, OMA, EggNOG
Opossum	100018915	KCNK13	potassium two pore domain channel subfamily K member 13	13616		Inparanoid, EggNOG
Chicken	772210	KCNK13	potassium two pore domain channel subfamily K member 13	9031	CGNC:8108	Inparanoid, OMA, EggNOG
Anole lizard	100562988	kcnk13	potassium two pore domain channel subfamily K member 13	28377		Inparanoid, OMA
Zebrafish	571467	kcnk13a	potassium channel, subfamily K, member 13a	7955	ZDB-GENE-080219-46	OMA, EggNOG
Zebrafish	556073	kcnk13b	potassium channel, subfamily K, member 13b	7955	ZDB-GENE-040724-105	Inparanoid, OMA
C. elegans	179699	twk-14	TWiK family of potassium channels	6239		OMA, EggNOG

DTO Classes
protein / Ion channel / Two pore domain potassium channel family / Potassium channel subfamily k member 13

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source