The store will not work correctly when cookies are disabled.
Protein or Target Summary
CTD nuclear envelope phosphatase 1
| Gene ID | 23399 |
|---|
| uniprot | O95476 |
|---|
| Gene Name | CTDNEP1 |
|---|
| Ensernbl ID | ENSP00000461749 |
|---|
| Family | Belongs to the dullard family. |
|---|
| Sequence | MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 23399 | CTDNEP1 | CTD nuclear envelope phosphatase 1 | O95476 |
| MOUSE | 67181 | Ctdnep1 | CTD nuclear envelope phosphatase 1 | Q3TP92 |
| MOUSE | | Ctdnep1 | CTD nuclear envelope phosphatase 1 | J3QPC9 |
| RAT | 287447 | Ctdnep1 | CTD nuclear envelope phosphatase 1 | Q3B7T6 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
