The store will not work correctly when cookies are disabled.
Protein or Target Summary
Glutathione S-transferase omega-1
| Gene ID | 9446 |
|---|
| uniprot | P78417 |
|---|
| Gene Name | GSTO1 |
|---|
| Ensernbl ID | ENSP00000358727 |
|---|
| Family | Belongs to the GST superfamily. Omega family. |
|---|
| Sequence | MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 9446 | GSTO1 | Glutathione S-transferase omega-1 | P78417 |
| MOUSE | 14873 | Gsto1 | Glutathione S-transferase omega-1 | O09131 |
| RAT | | Gsto1 | Glutathione S-transferase omega 1, isoform CRA_a | A0A096MJ04 |
| RAT | 114846 | Gsto1 | Glutathione S-transferase omega 1, isoform CRA_b | Q6AXR6 |
| RAT | | Gsto1 | Glutathione S-transferase omega-1 | Q9Z339 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
