The store will not work correctly when cookies are disabled.
GSTO1
| Description | Glutathione S-transferase omega-1 |
|---|
Gene and Protein Information
| Gene ID | 9446 |
|---|
| Uniprot Accession IDs | D3DRA3 F5H7H0 Q5TA03 Q7Z3T2 GSTO-1 |
|---|
| Ensembl ID | ENSP00000358727 |
|---|
| Symbol | GSTTLP28 P28 SPG-R GSTO 1-1 GSTTLp28 HEL-S-21 |
|---|
| Family | Belongs to the GST superfamily. Omega family. |
|---|
| Sequence | MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 450719 | GSTO1 | glutathione S-transferase omega 1 | 9598 | VGNC:12340 | Inparanoid, OMA, EggNOG |
| Macaque | 716078 | GSTO1 | glutathione S-transferase omega 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 14873 | Gsto1 | glutathione S-transferase omega 1 | 10090 | MGI:1342273 | Inparanoid, OMA, EggNOG |
| Rat | 114846 | Gsto1 | glutathione S-transferase omega 1 | 10116 | RGD:70952 | Inparanoid, OMA, EggNOG |
| Dog | 477813 | GSTO1 | glutathione S-transferase omega 1 | 9615 | VGNC:41536 | Inparanoid, OMA |
| Horse | 100069640 | GSTO1 | glutathione S-transferase omega 1 | 9796 | VGNC:18628 | Inparanoid, OMA |
| Cow | 785216 | GSTO1 | glutathione S-transferase omega 1 | 9913 | | Inparanoid, OMA |
| Pig | 397117 | GSTO1 | glutathione S-transferase omega 1 | 9823 | | Inparanoid, OMA |
| Chicken | 423881 | GSTO1 | glutathione S-transferase omega 1 | 9031 | CGNC:52072 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
