The store will not work correctly when cookies are disabled.
Protein or Target Summary
Glutathione S-transferase kappa 1
| Gene ID | 373156 |
|---|
| uniprot | Q9Y2Q3 |
|---|
| Gene Name | GSTK1 |
|---|
| Ensernbl ID | ENSP00000431049 |
|---|
| Family | Belongs to the GST superfamily. Kappa family. |
|---|
| Sequence | MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 373156 | GSTK1 | Glutathione S-transferase kappa 1 | Q9Y2Q3 |
| MOUSE | | Gstk1 | Glutathione S-transferase kappa 1 | A0A0N4SVE5 |
| MOUSE | 76263 | Gstk1 | Glutathione S-transferase kappa 1 | Q9DCM2 |
| RAT | 297029 | Gstk1 | Glutathione S-transferase kappa | B6DYQ0 |
| RAT | 297029 | Gstk1 | Glutathione S-transferase kappa 1 | P24473 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
