The store will not work correctly when cookies are disabled.
Protein or Target Summary
Glutathione S-transferase Mu 1
| Gene ID | 2944 |
|---|
| uniprot | P09488 |
|---|
| Gene Name | GSTM1 |
|---|
| Ensernbl ID | ENSP00000311469 |
|---|
| Family | Belongs to the GST superfamily. Mu family. |
|---|
| Sequence | MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 2944 | GSTM1 | Glutathione S-transferase Mu 1 | P09488 |
| MOUSE | | Gstm1 | Glutathione S-transferase Mu 1 | F6WHQ7 |
| MOUSE | 14862 | Gstm1 | Glutathione S-transferase Mu 1 | A2AE89 |
| MOUSE | 14862 | Gstm1 | Glutathione S-transferase Mu 1 | P10649 |
| RAT | | Gstm1 | Glutathione S-transferase Mu 1 | G3V983 |
| RAT | 24423 | Gstm1 | Glutathione S-transferase Mu 1 | P04905 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
