The store will not work correctly when cookies are disabled.
GSTM1
| Description | Glutathione S-transferase Mu 1 |
|---|
Gene and Protein Information
| Gene ID | 2944 |
|---|
| Uniprot Accession IDs | Q5GHG0 Q6FH88 Q8TC98 Q9UC96 |
|---|
| Ensembl ID | ENSP00000311469 |
|---|
| Symbol | GST1 MU H-B GST1 GTH4 GTM1 MU-1 GSTM1-1 GSTM1a-1a GSTM1b-1b |
|---|
| Family | Belongs to the GST superfamily. Mu family. |
|---|
| Sequence | MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 745723 | GSTM1 | glutathione S-transferase mu 1 | 9598 | VGNC:14256 | OMA, EggNOG |
| Macaque | | GSTM1 | glutathione S-transferase mu 1 [Source:HGNC Symbol;Acc:HGNC:4632] | 9544 | | Inparanoid, OMA |
| Mouse | 14863 | Gstm2 | glutathione S-transferase, mu 2 | 10090 | MGI:95861 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
