The store will not work correctly when cookies are disabled.
GSTM2
| Description | Glutathione S-transferase Mu 2 |
|---|
Gene and Protein Information
| Gene ID | 2946 |
|---|
| Uniprot Accession IDs | B4DRY4 E9PEM9 Q2M318 Q5TZY5 Q8WWE1 |
|---|
| Ensembl ID | ENSP00000241337 |
|---|
| Symbol | GST4 GST4 GSTM GTHMUS GSTM2-2 |
|---|
| Family | Belongs to the GST superfamily. Mu family. |
|---|
| Sequence | MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK |
|---|
Homologous gene and protein info.
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
