The store will not work correctly when cookies are disabled.
Protein or Target Summary
Glutathione S-transferase Mu 2
| Gene ID | 2946 |
|---|
| uniprot | P28161 |
|---|
| Gene Name | GSTM2 |
|---|
| Ensernbl ID | ENSP00000241337 |
|---|
| Family | Belongs to the GST superfamily. Mu family. |
|---|
| Sequence | MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 2946 | GSTM2 | Glutathione S-transferase Mu 2 | P28161 |
| MOUSE | | Gstm2 | Glutathione S-transferase | D3YX76 |
| MOUSE | 14863 | Gstm2 | Glutathione S-transferase Mu 2 | P15626 |
| RAT | 24424 | Gstm2 | Glutathione S-transferase | B6DYQ2 |
| RAT | 24424 | Gstm2 | Glutathione S-transferase Mu 2 | P08010 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
