The store will not work correctly when cookies are disabled.
FABP2
| Description | Fatty acid-binding protein, intestinal |
|---|
Gene and Protein Information
| Gene ID | 2169 |
|---|
| Uniprot Accession IDs | Q2NKJ1 |
|---|
| Ensembl ID | ENSP00000274024 |
|---|
| Symbol | FABPI FABPI I-FABP |
|---|
| Family | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
|---|
| Sequence | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 740421 | FABP2 | fatty acid binding protein 2 | 9598 | VGNC:7045 | OMA, EggNOG |
| Mouse | 14079 | Fabp2 | fatty acid binding protein 2, intestinal | 10090 | MGI:95478 | Inparanoid, OMA, EggNOG |
| Rat | 25598 | Fabp2 | fatty acid binding protein 2 | 10116 | RGD:2591 | Inparanoid, OMA, EggNOG |
| Dog | 487924 | FABP2 | fatty acid binding protein 2 | 9615 | VGNC:40560 | Inparanoid, OMA, EggNOG |
| Horse | 100034050 | FABP2 | fatty acid binding protein 2 | 9796 | VGNC:17767 | OMA, EggNOG |
| Cow | | FABP2 | fatty acid binding protein 2 [Source:HGNC Symbol;Acc:HGNC:3556] | 9913 | | OMA, EggNOG |
| Opossum | 100011805 | FABP2 | fatty acid binding protein 2 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100081780 | FABP2 | fatty acid binding protein 2 | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 422678 | FABP2 | fatty acid binding protein 2 | 9031 | CGNC:9084 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100566943 | fabp2 | fatty acid binding protein 2 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100101805 | fabp2 | fatty acid binding protein 2 | 8364 | XB-GENE-485137 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30708 | fabp2 | fatty acid binding protein 2, intestinal | 7955 | ZDB-GENE-991019-5 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
