The store will not work correctly when cookies are disabled.
Protein or Target Summary
Fatty acid-binding protein, intestinal
| Gene ID | 2169 |
|---|
| uniprot | P12104 |
|---|
| Gene Name | FABP2 |
|---|
| Ensernbl ID | ENSP00000274024 |
|---|
| Family | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
|---|
| Sequence | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 2169 | FABP2 | Fatty acid-binding protein, intestinal | P12104 |
| MOUSE | 14079 | Fabp2 | Fatty acid-binding protein, intestinal | P55050 |
| MOUSE | 14079 | Fabp2 | Fatty acid binding protein 2, intestinal | Q53YP5 |
| RAT | 25598 | Fabp2 | Fatty acid-binding protein, intestinal | P02693 |
| RAT | | Fabp2 | Fatty acid-binding protein, intestinal | A0A0A0MY01 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
