The store will not work correctly when cookies are disabled.
FABP1
| Description | Fatty acid-binding protein, liver |
|---|
Gene and Protein Information
| Gene ID | 2168 |
|---|
| Uniprot Accession IDs | P07148 |
|---|
| Ensembl ID | ENSP00000295834 |
|---|
| Symbol | FABPL FABPL L-FABP |
|---|
| Family | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
|---|
| Sequence | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 736471 | FABP1 | fatty acid binding protein 1 | 9598 | VGNC:7696 | OMA, EggNOG |
| Mouse | 14080 | Fabp1 | fatty acid binding protein 1, liver | 10090 | MGI:95479 | Inparanoid, OMA, EggNOG |
| Rat | 24360 | Fabp1 | fatty acid binding protein 1 | 10116 | RGD:2590 | Inparanoid, OMA, EggNOG |
| Dog | 403619 | FABP1 | fatty acid binding protein 1 | 9615 | VGNC:40558 | Inparanoid, OMA, EggNOG |
| Horse | 100052746 | FABP1 | fatty acid binding protein 1 | 9796 | VGNC:17765 | Inparanoid, OMA, EggNOG |
| Cow | 327700 | FABP1 | fatty acid binding protein 1 | 9913 | VGNC:28695 | Inparanoid, OMA, EggNOG |
| Pig | 445535 | FABP1 | fatty acid binding protein 1 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | | FABP1 | fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555] | 13616 | | Inparanoid, EggNOG |
| Platypus | | FABP1 | fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555] | 9258 | | OMA, EggNOG |
| Chicken | 374015 | FABP1 | fatty acid binding protein 1 | 9031 | CGNC:11895 | OMA, EggNOG |
| Anole lizard | 100562032 | fabp1 | fatty acid binding protein 1 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100144636 | fabp1 | fatty acid binding protein 1 | 8364 | XB-GENE-481608 | Inparanoid, OMA, EggNOG |
| Zebrafish | 791610 | fabp1a | fatty acid binding protein 1a, liver | 7955 | ZDB-GENE-020318-3 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
