Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

FABP1

DescriptionFatty acid-binding protein, liver

Gene and Protein Information

Gene ID2168
Uniprot Accession IDs P07148
Ensembl ID ENSP00000295834
Symbol FABPL FABPL L-FABP
FamilyBelongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp736471FABP1fatty acid binding protein 19598VGNC:7696OMA, EggNOG
Mouse14080Fabp1fatty acid binding protein 1, liver10090MGI:95479Inparanoid, OMA, EggNOG
Rat24360Fabp1fatty acid binding protein 110116RGD:2590Inparanoid, OMA, EggNOG
Dog403619FABP1fatty acid binding protein 19615VGNC:40558Inparanoid, OMA, EggNOG
Horse100052746FABP1fatty acid binding protein 19796VGNC:17765Inparanoid, OMA, EggNOG
Cow327700FABP1fatty acid binding protein 19913VGNC:28695Inparanoid, OMA, EggNOG
Pig445535FABP1fatty acid binding protein 19823Inparanoid, OMA, EggNOG
OpossumFABP1fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555]13616Inparanoid, EggNOG
PlatypusFABP1fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555]9258OMA, EggNOG
Chicken374015FABP1fatty acid binding protein 19031CGNC:11895OMA, EggNOG
Anole lizard100562032fabp1fatty acid binding protein 128377Inparanoid, OMA, EggNOG
Xenopus100144636fabp1fatty acid binding protein 18364XB-GENE-481608Inparanoid, OMA, EggNOG
Zebrafish791610fabp1afatty acid binding protein 1a, liver7955ZDB-GENE-020318-3Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details
Recombinant Human FABP1/L-FABP ProteinE. coliC-His
Out of Stock
Expand

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      active Crohn's disease1059Expression AtlasMONDO:0005011
      active ulcerative colitis2513Expression AtlasMONDO:0005101
      colon cancer1587Expression AtlasMONDO:0021063
      nephrosclerosis331Expression AtlasMONDO:0006044
      pancreatic ductal adenocarcinoma liver metastasis3122Expression AtlasMONDO:0005184
      psoriasis6696Expression AtlasMONDO:0005083
      Kidney Failure, Chronic118CTDMONDO:0005300
      Kidney Tubular Necrosis, Acute4CTDMONDO:0006637
      Lipidoses19CTDMONDO:0019245
      Kidney Failure, Chronic118DisGeNETMONDO:0005300

      Bibliography

      1.Wolfrum, C C, Börchers, T T, Sacchettini, J C JC and Spener, F F. 2000-02-15 Binding of fatty acids and peroxisome proliferators to orthologous fatty acid binding proteins from human, murine, and bovine liver. [PMID:10684629]
      2.Wolfrum, C C, Borrmann, C M CM, Borchers, T T and Spener, F F. 2001-02-27 Fatty acids and hypolipidemic drugs regulate peroxisome proliferator-activated receptors alpha - and gamma-mediated gene expression via liver fatty acid binding protein: a signaling path to the nucleus. [PMID:11226238]
      3.Schroeder, F F and 7 more authors. 2001-03 Expression of liver fatty acid binding protein alters growth and differentiation of embryonic stem cells. [PMID:11354243]
      4.Zimmerman, A W AW, van Moerkerk, H T HT and Veerkamp, J H JH. 2001-09 Ligand specificity and conformational stability of human fatty acid-binding proteins. [PMID:11461829]
      5.Mésange, Fabienne F and 7 more authors.Identification of two tamoxifen target proteins by photolabeling with 4-(2-morpholinoethoxy)benzophenone. [PMID:12121132]
      6.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      7.Divine, Joyce K JK, McCaul, Sean P SP and Simon, Theodore C TC. 2003-07 HNF-1alpha and endodermal transcription factors cooperatively activate Fabpl: MODY3 mutations abrogate cooperativity. [PMID:12646418]
      8.Pelsers, Maurice M A L MM and 6 more authors. 2003-10 Intestinal-type and liver-type fatty acid-binding protein in the intestine. Tissue distribution and clinical utility. [PMID:14563446]
      9.Brouillette, Charles C, Bossé, Yohan Y, Pérusse, Louis L, Gaudet, Daniel D and Vohl, Marie-Claude MC. 2004 Effect of liver fatty acid binding protein (FABP) T94A missense mutation on plasma lipoprotein responsiveness to treatment with fenofibrate. [PMID:15249972]
      10.Robitaille, J J and 5 more authors. 2004-08 Plasma concentrations of apolipoprotein B are modulated by a gene--diet interaction effect between the LFABP T94A polymorphism and dietary fat intake in French-Canadian men. [PMID:15308127]