The store will not work correctly when cookies are disabled.
Protein or Target Summary
Fatty acid-binding protein, liver
| Gene ID | 2168 |
|---|
| uniprot | P07148 |
|---|
| Gene Name | FABP1 |
|---|
| Ensernbl ID | ENSP00000295834 |
|---|
| Family | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
|---|
| Sequence | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 2168 | FABP1 | Fatty acid-binding protein, liver | P07148 |
| MOUSE | 14080 | Fabp1 | Fatty acid binding protein 1, liver | Q3V2F7 |
| MOUSE | 14080 | Fabp1 | Fatty acid-binding protein, liver | P12710 |
| RAT | 24360 | Fabp1 | Fatty acid-binding protein, liver | P02692 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
