The store will not work correctly when cookies are disabled.
HIST1H2BB
| Description | Histone H2B type 1-B |
|---|
Gene and Protein Information
| Gene ID | 3018 |
|---|
| Uniprot Accession IDs | Q4KN36 |
|---|
| Ensembl ID | ENSP00000482674 |
|---|
| Symbol | H2BFF H2B.1 H2B/f H2BFF |
|---|
| Family | Belongs to the histone H2B family. |
|---|
| Sequence | MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK |
|---|
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
