JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Insulin-like growth factor-binding protein 1

Gene ID	3484
uniprot	P08833
Gene Name	IGFBP1
Ensernbl ID	ENSP00000275525
Sequence	MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	3484	IGFBP1	Insulin-like growth factor-binding protein 1	P08833
MOUSE	16006	Igfbp1	Insulin-like growth factor-binding protein 1	P47876
RAT	25685	Igfbp1	Insulin-like growth factor-binding protein 1	P21743

Protein Classes

PANTHER Classes
protein / protease inhibitor / Insulin-like growth factor-binding protein 1

DTO Classes
protein / Enzyme modulator / Protease inhibitor / Insulin-like growth factor-binding protein 1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx