The store will not work correctly when cookies are disabled.
IGFBP1
Description | Insulin-like growth factor-binding protein 1 |
---|
Gene and Protein Information
Gene ID | 3484 |
Uniprot Accession IDs | A4D2F4 D3DVL9 Q8IYP5 IBP-1 |
Ensembl ID | ENSP00000275525 |
Symbol | IBP1 AFBP IBP1 PP12 IGF-BP25 hIGFBP-1 |
Sequence | MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 463395 | IGFBP1 | insulin like growth factor binding protein 1 | 9598 | VGNC:4397 | OMA, EggNOG |
Macaque | 696994 | IGFBP1 | insulin like growth factor binding protein 1 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 16006 | Igfbp1 | insulin-like growth factor binding protein 1 | 10090 | MGI:96436 | Inparanoid, OMA, EggNOG |
Rat | 25685 | Igfbp1 | insulin-like growth factor binding protein 1 | 10116 | RGD:2872 | Inparanoid, OMA |
Dog | 480812 | IGFBP1 | insulin like growth factor binding protein 1 | 9615 | VGNC:41902 | Inparanoid, OMA, EggNOG |
Horse | 100034154 | IGFBP1 | insulin like growth factor binding protein 1 | 9796 | VGNC:18973 | Inparanoid, OMA, EggNOG |
Cow | 282259 | IGFBP1 | insulin like growth factor binding protein 1 | 9913 | VGNC:30083 | Inparanoid, OMA, EggNOG |
Pig | 397270 | IGFBP1 | insulin like growth factor binding protein 1 | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 100030454 | IGFBP1 | insulin like growth factor binding protein 1 | 13616 | | Inparanoid, OMA, EggNOG |
Platypus | 100076308 | IGFBP1 | insulin like growth factor binding protein 1 | 9258 | | Inparanoid, OMA, EggNOG |
Anole lizard | 100564199 | igfbp1 | insulin like growth factor binding protein 1 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 619366 | igfbp1 | insulin like growth factor binding protein 1 | 8364 | XB-GENE-485497 | Inparanoid, OMA, EggNOG |
Zebrafish | 793907 | igfbp1b | insulin-like growth factor binding protein 1b | 7955 | ZDB-GENE-081210-3 | Inparanoid, OMA |
Protein Classes
PANTHER Classes protein /
protease inhibitor / Insulin-like growth factor-binding protein 1
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|