IGFBP6

Description	Insulin-like growth factor-binding protein 6

Gene and Protein Information

Gene ID	3489
Uniprot Accession IDs	Q14492 IBP-6
Ensembl ID	ENSP00000301464
Symbol	IBP6 IBP6
Sequence	MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	451929	IGFBP6	insulin like growth factor binding protein 6	9598	VGNC:5428	OMA, EggNOG
Mouse	16012	Igfbp6	insulin-like growth factor binding protein 6	10090	MGI:96441	Inparanoid, OMA, EggNOG
Rat	25641	Igfbp6	insulin-like growth factor binding protein 6	10116	RGD:2877	Inparanoid, OMA, EggNOG
Dog	607374	IGFBP6	insulin like growth factor binding protein 6	9615	VGNC:41907	Inparanoid, OMA, EggNOG
Horse	100034156	IGFBP6	insulin like growth factor binding protein 6	9796	VGNC:18975	Inparanoid, OMA, EggNOG
Cow	404186	IGFBP6	insulin like growth factor binding protein 6	9913	VGNC:30088	Inparanoid, OMA, EggNOG
Pig	100101923	IGFBP6	insulin like growth factor binding protein 6	9823		Inparanoid, OMA, EggNOG

PANTHER Classes
protein / protease inhibitor / Insulin-like growth factor-binding protein 6

DTO Classes
protein / Enzyme modulator / Protease inhibitor / Insulin-like growth factor-binding protein 6

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source