Click Here for 5% Off Your First Aladdin Purchase!
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

Protein or Target Summary

Glycoprotein hormones alpha chain

Gene ID1081
uniprotP01215
Gene NameCGA
Ensernbl IDENSP00000482232
FamilyBelongs to the glycoprotein hormones subunit alpha family.
Sequence
MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN1081CGAGlycoprotein hormones alpha chainP01215
MOUSECgaGlycoprotein hormones alpha chainA2AVN2
MOUSE12640CgaGlycoprotein hormones alpha chainA0A0F7RQH1
MOUSE12640CgaGlycoprotein hormones alpha chainP01216
RAT116700CgaGlycoprotein hormones alpha chainA0A0F7RQ24
RAT116700CgaGlycoprotein hormones alpha chainQ6P509
RAT116700CgaGlycoprotein hormones alpha chainP11962

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Source: DataSourcesLicenses.xlsx
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.