The store will not work correctly when cookies are disabled.
Protein or Target Summary
Glycoprotein hormones alpha chain
Gene ID | 1081 |
uniprot | P01215 |
Gene Name | CGA |
Ensernbl ID | ENSP00000482232 |
Family | Belongs to the glycoprotein hormones subunit alpha family. |
Sequence | MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 1081 | CGA | Glycoprotein hormones alpha chain | P01215 |
MOUSE | | Cga | Glycoprotein hormones alpha chain | A2AVN2 |
MOUSE | 12640 | Cga | Glycoprotein hormones alpha chain | A0A0F7RQH1 |
MOUSE | 12640 | Cga | Glycoprotein hormones alpha chain | P01216 |
RAT | 116700 | Cga | Glycoprotein hormones alpha chain | A0A0F7RQ24 |
RAT | 116700 | Cga | Glycoprotein hormones alpha chain | Q6P509 |
RAT | 116700 | Cga | Glycoprotein hormones alpha chain | P11962 |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|