The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
GYPA
Gene and Protein Information
| Gene ID | 2993 |
|---|
| Uniprot Accession IDs | P02724 A8K3E6 B8Q182 B8Q185 Q9BS51 |
|---|
| Ensembl ID | ENSP00000354003 |
|---|
| Symbol | GPA MN GPA MNS GPSAT PAS-2 CD235a GPErik HGpMiV HGpMiXI HGpSta(C) |
|---|
| Family | Belongs to the glycophorin A family. |
|---|
| Sequence | MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 461520 | GYPA | glycophorin A (MNS blood group) | 9598 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
The page will load shortly, Thanks for your patience!
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
The page will load shortly, Thanks for your patience!
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
The page will load shortly, Thanks for your patience!
