The store will not work correctly when cookies are disabled.
GYPA
Gene and Protein Information
| Gene ID | 2993 |
|---|
| Uniprot Accession IDs | A8K3E6 B8Q182 B8Q185 Q9BS51 |
|---|
| Ensembl ID | ENSP00000354003 |
|---|
| Symbol | GPA MN GPA MNS GPSAT PAS-2 CD235a GPErik HGpMiV HGpMiXI HGpSta(C) |
|---|
| Family | Belongs to the glycophorin A family. |
|---|
| Sequence | MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 461520 | GYPA | glycophorin A (MNS blood group) | 9598 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
