The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 121504 |
|---|
| Uniprot Accession IDs | A2VCL0 P02304 P02305 Q6DRA9 Q6FGB8 Q6NWP7 |
|---|
| Ensembl ID | ENSP00000484789 |
|---|
| Symbol | H4/A H4FA H4/p |
|---|
| Family | Belongs to the histone H4 family. |
|---|
| Sequence | MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 326619 | Hist1h4a | histone cluster 1, H4a | 10090 | MGI:2448419 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
