The store will not work correctly when cookies are disabled.
Protein or Target Summary
Islet amyloid polypeptide
| Gene ID | 3375 |
|---|
| uniprot | P10997 |
|---|
| Gene Name | IAPP |
|---|
| Ensernbl ID | ENSP00000240652 |
|---|
| Family | Belongs to the calcitonin family. |
|---|
| Sequence | MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 3375 | IAPP | Islet amyloid polypeptide | P10997 |
| MOUSE | 15874 | Iapp | Islet amyloid polypeptide | P12968 |
| RAT | 24476 | Iapp | Islet amyloid polypeptide | P12969 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
