JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Appetite-regulating hormone

Gene ID	51738
uniprot	Q9UBU3
Gene Name	GHRL
Ensernbl ID	ENSP00000335074
Family	Belongs to the motilin family.
Sequence	MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	51738	GHRL	Appetite-regulating hormone	Q9UBU3
MOUSE		Ghrl	Appetite-regulating hormone	A0A0N4SVC9
MOUSE	58991	Ghrl	Ghrelin	A2RSS9
MOUSE	58991	Ghrl	Appetite-regulating hormone	Q7TSD1
MOUSE	58991	Ghrl	Appetite-regulating hormone	Q811T4
MOUSE	58991	Ghrl	Appetite-regulating hormone	Q9EQX0
RAT	59301	Ghrl	Appetite-regulating hormone	Q9QYH7

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx