JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

P2X purinoceptor 5

Gene ID	5026
uniprot	Q93086
Gene Name	P2RX5
Ensernbl ID	ENSP00000225328
Family	Belongs to the P2X receptor family.
Sequence	MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	5026	P2RX5	P2X purinoceptor 5	Q93086
MOUSE		P2rx5	P2X purinoceptor	B7ZND5
MOUSE		P2rx5	P2X purinoceptor	B1AUD7
MOUSE		P2rx5	Purinergic receptor P2X5-2	U3LZP7
MOUSE	94045	P2rx5	P2X purinoceptor	B9EHM6
MOUSE		P2rx5	Purinergic receptor P2X, ligand-gated ion channel, 5	B1AUD6
MOUSE		P2rx5	P2X purinoceptor	Q91VE2
MOUSE	94045	P2rx5	P2X purinoceptor	Q3UYI1
RAT		P2rx5	P2X purinoceptor	G3V8I0
RAT	113995	P2rx5	P2X purinoceptor 5	P51578

Protein Classes

DTO Classes
protein / Ion channel / ATP-gated p2x receptor cation channel (p2x receptor) family / P2X purinoceptor 5

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx