The store will not work correctly when cookies are disabled.
Protein or Target Summary
Phospholipase A2
| Gene ID | 5319 |
|---|
| uniprot | P04054 |
|---|
| Gene Name | PLA2G1B |
|---|
| Ensernbl ID | ENSP00000312286 |
|---|
| Family | Belongs to the phospholipase A2 family. |
|---|
| Sequence | MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5319 | PLA2G1B | Phospholipase A2 | P04054 |
| MOUSE | | Pla2g1b | Phospholipase A(2) | S4R2K6 |
| MOUSE | | Pla2g1b | Phospholipase A(2) | D3Z1N8 |
| MOUSE | | Pla2g1b | Phospholipase A(2) | D3YWH2 |
| MOUSE | 18778 | Pla2g1b | Phospholipase A2 | Q9Z0Y2 |
| RAT | 29526 | Pla2g1b | Phospholipase A2 | P04055 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
