The store will not work correctly when cookies are disabled.
PARP11
| Description | Poly [ADP-ribose] polymerase 11 |
|---|
Gene and Protein Information
| Gene ID | 57097 |
|---|
| Uniprot Accession IDs | B4DRQ0 F8WBZ7 Q68DS1 Q8N5Y9 PARP-11 |
|---|
| Ensembl ID | ENSP00000228820 |
|---|
| Symbol | C12orf6 ARTD11 MIB006 C12orf6 |
|---|
| Sequence | MWEANPEMFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 466921 | PARP11 | poly(ADP-ribose) polymerase family member 11 | 9598 | VGNC:8610 | OMA, EggNOG |
| Macaque | 721828 | PARP11 | poly(ADP-ribose) polymerase family member 11 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 101187 | Parp11 | poly (ADP-ribose) polymerase family, member 11 | 10090 | MGI:2141505 | Inparanoid, OMA, EggNOG |
| Rat | 500323 | Parp11 | poly (ADP-ribose) polymerase family, member 11 | 10116 | RGD:1561791 | Inparanoid, OMA |
| Dog | 477722 | PARP11 | poly(ADP-ribose) polymerase family member 11 | 9615 | | Inparanoid, OMA, EggNOG |
| Horse | 100057934 | PARP11 | poly(ADP-ribose) polymerase family member 11 | 9796 | VGNC:53557 | Inparanoid, OMA, EggNOG |
| Cow | 539763 | PARP11 | poly(ADP-ribose) polymerase family member 11 | 9913 | VGNC:49073 | Inparanoid, OMA, EggNOG |
| Pig | 100524437 | PARP11 | poly(ADP-ribose) polymerase family member 11 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100016300 | PARP11 | poly(ADP-ribose) polymerase family member 11 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 418264 | PARP11 | poly(ADP-ribose) polymerase family member 11 | 9031 | CGNC:10681 | Inparanoid, OMA |
| Anole lizard | 100564255 | parp11 | poly(ADP-ribose) polymerase family member 11 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100135750 | parp11 | poly(ADP-ribose) polymerase family member 11 | 8364 | XB-GENE-979660 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
