The store will not work correctly when cookies are disabled.
Protein or Target Summary
Paired box protein Pax-8
| Gene ID | 7849 |
|---|
| uniprot | Q06710 |
|---|
| Gene Name | PAX8 |
|---|
| Ensernbl ID | ENSP00000263334 |
|---|
| Sequence | MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 7849 | PAX8 | Paired box protein Pax-8 | Q06710 |
| MOUSE | | Pax8 | Paired box protein Pax-8 | A2AIU7 |
| MOUSE | | Pax8 | Paired box protein Pax-8 | A2AIU6 |
| MOUSE | | Pax8 | Paired box protein Pax-8 | A2AIU8 |
| MOUSE | | Pax8 | Paired box protein Pax-8 | G3UZ49 |
| MOUSE | 18510 | Pax8 | Paired box protein Pax-8 | Q00288 |
| RAT | | Pax8 | Paired box protein Pax-8 | A0A0G2JY90 |
| RAT | 81819 | Pax8 | Paired box protein Pax-8 | P51974 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
