Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
྾

PAK3

DescriptionSerine/threonine-protein kinase PAK 3

Gene and Protein Information

Gene ID5063
Uniprot Accession IDs O75914 A8K389 B1GX77 B1GX78 B1GX79 Q5JWX1 Q5JWX2 Q7Z2D6 Q7Z2E4 Q7Z3Z8 Q8WWK5 Q8WX23 Q9P0J8
Ensembl ID ENSP00000353864
Symbol OPHN3 ARA bPAK MRX30 MRX47 OPHN3 PAK-3 PAK3beta beta-PAK
FamilyBelongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Sequence
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp450118PAK3p21 (RAC1) activated kinase 39598VGNC:10463Inparanoid, OMA, EggNOG
Mouse18481Pak3p21 (RAC1) activated kinase 310090MGI:1339656Inparanoid, OMA, EggNOG
Rat29433Pak3p21 (RAC1) activated kinase 310116RGD:3251Inparanoid, OMA
Dog492067PAK3p21 (RAC1) activated kinase 39615VGNC:53550Inparanoid, OMA, EggNOG
Horse100054315PAK3p21 (RAC1) activated kinase 39796Inparanoid, OMA, EggNOG
Cow534526PAK3p21 (RAC1) activated kinase 39913VGNC:53659Inparanoid, OMA, EggNOG
Opossum100012727PAK3p21 (RAC1) activated kinase 313616Inparanoid, OMA, EggNOG
Platypus100073584PAK3p21 (RAC1) activated kinase 39258Inparanoid, OMA, EggNOG
Chicken422342PAK3p21 (RAC1) activated kinase 39031CGNC:6100Inparanoid, OMA
Anole lizard100552681pak3p21 (RAC1) activated kinase 328377Inparanoid, OMA
Xenopus100495025pak3p21 protein (Cdc42/Rac)-activated kinase 38364XB-GENE-961764Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Kinase    /    Protein kinase    /    STE group    /    STE20 family    /    PAKA subfamily    /    Serine/threonine-protein kinase pak 3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

The page will load shortly, Thanks for your patience!
NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      The page will load shortly, Thanks for your patience!
      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      The page will load shortly, Thanks for your patience!
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.