The store will not work correctly when cookies are disabled.
Protein or Target Summary
P2Y purinoceptor 12
| Gene ID | 64805 |
|---|
| uniprot | Q9H244 |
|---|
| Gene Name | P2RY12 |
|---|
| Ensernbl ID | ENSP00000307259 |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 64805 | P2RY12 | P2Y purinoceptor 12 | Q9H244 |
| MOUSE | | P2ry12 | P2Y purinoceptor 12 | A0A0G2JGU7 |
| MOUSE | | P2ry12 | Uncharacterized protein | Q8BZV8 |
| MOUSE | 70839 | P2ry12 | Purinergic receptor P2Y, G-protein coupled 12, isoform CRA_a | Q546L4 |
| MOUSE | 70839 | P2ry12 | P2Y purinoceptor 12 | Q9CPV9 |
| RAT | 64803 | P2ry12 | P2Y purinoceptor 12 | Q9EPX4 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
