The store will not work correctly when cookies are disabled.
P2RY12
| Description | P2Y purinoceptor 12 |
|---|
Gene and Protein Information
| Gene ID | 64805 |
|---|
| Uniprot Accession IDs | D3DNJ5 Q546J7 P2Y12 |
|---|
| Ensembl ID | ENSP00000307259 |
|---|
| Symbol | HORK3 HORK3 P2Y12 ADPG-R BDPLT8 SP1999 P2T(AC) P2Y(AC) P2Y(12)R P2Y(ADP) P2Y(cyc) |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 710036 | P2RY12 | purinergic receptor P2Y12 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 70839 | P2ry12 | purinergic receptor P2Y, G-protein coupled 12 | 10090 | MGI:1918089 | Inparanoid, OMA, EggNOG |
| Rat | 64803 | P2ry12 | purinergic receptor P2Y12 | 10116 | RGD:621681 | Inparanoid, OMA, EggNOG |
| Dog | 442958 | P2RY12 | purinergic receptor P2Y12 | 9615 | VGNC:44214 | Inparanoid, OMA, EggNOG |
| Horse | 100630046 | P2RY12 | purinergic receptor P2Y12 | 9796 | VGNC:21110 | Inparanoid, OMA, EggNOG |
| Cow | 408007 | P2RY12 | purinergic receptor P2Y12 | 9913 | VGNC:32525 | Inparanoid, OMA, EggNOG |
| Pig | 503659 | P2RY12 | purinergic receptor P2Y12 | 9823 | | OMA, EggNOG |
| Opossum | 100618708 | P2RY12 | purinergic receptor P2Y12 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100682030 | P2RY12 | purinergic receptor P2Y12 | 9258 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 103278184 | p2ry12 | purinergic receptor P2Y12 | 28377 | | Inparanoid, OMA |
| Xenopus | 100493410 | p2ry12 | purinergic receptor P2Y, G-protein coupled, 12 | 8364 | XB-GENE-947453 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
