Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

P2RX4

DescriptionP2X purinoceptor 4

Gene and Protein Information

Gene ID5025
Uniprot Accession IDs E7EPF7 F6RU17 O00450 O14722 Q5U089 Q5U090 Q8N4N1 Q9UBG9 P2X4
Ensembl ID ENSP00000353032
Symbol P2X4 P2X4R
FamilyBelongs to the P2X receptor family.
Sequence
MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp452319P2RX4purinergic receptor P2X 49598VGNC:8487OMA, EggNOG
Macaque702536P2RX4purinergic receptor P2X 49544Inparanoid, OMA, EggNOG
Mouse18438P2rx4purinergic receptor P2X, ligand-gated ion channel 410090MGI:1338859Inparanoid, OMA, EggNOG
Rat29659P2rx4purinergic receptor P2X 410116RGD:62073Inparanoid, OMA, EggNOG
Dog448783P2RX4purinergic receptor P2X 49615VGNC:44210Inparanoid, OMA, EggNOG
Horse100059626P2RX4purinergic receptor P2X 49796VGNC:50960Inparanoid, OMA, EggNOG
Cow338036P2RX4purinergic receptor P2X 49913VGNC:32520Inparanoid, OMA, EggNOG
Opossum100618270P2RX4purinergic receptor P2X 413616Inparanoid, OMA, EggNOG
PlatypusP2RX4purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535]9258OMA, EggNOG
Chicken374166P2RX4purinergic receptor P2X 49031CGNC:2857Inparanoid, OMA
Anole lizard100561452p2rx4purinergic receptor P2X 428377Inparanoid, OMA
Xenopus100489363p2rx4purinergic receptor P2X, ligand gated ion channel, 48364XB-GENE-967965Inparanoid, OMA
Zebrafish259258p2rx4apurinergic receptor P2X, ligand-gated ion channel, 4a7955ZDB-GENE-020806-2Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Ion channel    /    ATP-gated p2x receptor cation channel (p2x receptor) family    /    P2X purinoceptor 4

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      acute myeloid leukemia927Expression AtlasMONDO:0018874
      esophageal adenocarcinoma754Expression AtlasMONDO:0005028
      glioblastoma5998Expression AtlasMONDO:0018177
      intraductal papillary-mucinous neoplasm (IPMN)3325Expression AtlasMONDO:0004286
      malignant mesothelioma3244Expression AtlasMONDO:0006292
      ulcerative colitis2513Expression AtlasMONDO:0005101
      Epilepsy82CTDMONDO:0005027
      Epilepsy, Temporal Lobe23CTDMONDO:0005115
      Epilepsy82DisGeNETMONDO:0005027
      Epilepsy, Temporal Lobe23DisGeNETMONDO:0005115

      Bibliography

      1.Carpenter, D D and 13 more authors. 1999-10-08 Site-specific splice variation of the human P2X4 receptor. [PMID:10515189]
      2.Yamamoto, K K and 5 more authors. 2000-07 P2X(4) receptors mediate ATP-induced calcium influx in human vascular endothelial cells. [PMID:10899068]
      3.Yamamoto, K K, Korenaga, R R, Kamiya, A A and Ando, J J. 2000-09-01 Fluid shear stress activates Ca(2+) influx into human endothelial cells via P2X4 purinoceptors. [PMID:10969036]
      4.Korenaga, R R and 5 more authors. 2001-05 Sp1-mediated downregulation of P2X4 receptor gene transcription in endothelial cells exposed to shear stress. [PMID:11299224]
      5.Hu, B B and 5 more authors. 2001-12 A novel contractile phenotype with cardiac transgenic expression of the human P2X4 receptor. [PMID:11606481]
      6.Glass, R R, Loesch, A A, Bodin, P P and Burnstock, G G. 2002-05 P2X4 and P2X6 receptors associate with VE-cadherin in human endothelial cells. [PMID:12088286]
      7. and North, R Alan RA. 2002-10 Molecular physiology of P2X receptors. [PMID:12270951]
      8.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      9.Yamamoto, Kimiko K and 5 more authors. 2003-08 Endogenously released ATP mediates shear stress-induced Ca2+ influx into pulmonary artery endothelial cells. [PMID:12714321]
      10.Coddou, Claudio C and 7 more authors. 2003-09-19 Histidine 140 plays a key role in the inhibitory modulation of the P2X4 nucleotide receptor by copper but not zinc. [PMID:12819199]