The store will not work correctly when cookies are disabled.
P2RX4
| Description | P2X purinoceptor 4 |
|---|
Gene and Protein Information
| Gene ID | 5025 |
|---|
| Uniprot Accession IDs | E7EPF7 F6RU17 O00450 O14722 Q5U089 Q5U090 Q8N4N1 Q9UBG9 P2X4 |
|---|
| Ensembl ID | ENSP00000353032 |
|---|
| Symbol | P2X4 P2X4R |
|---|
| Family | Belongs to the P2X receptor family. |
|---|
| Sequence | MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 452319 | P2RX4 | purinergic receptor P2X 4 | 9598 | VGNC:8487 | OMA, EggNOG |
| Macaque | 702536 | P2RX4 | purinergic receptor P2X 4 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 18438 | P2rx4 | purinergic receptor P2X, ligand-gated ion channel 4 | 10090 | MGI:1338859 | Inparanoid, OMA, EggNOG |
| Rat | 29659 | P2rx4 | purinergic receptor P2X 4 | 10116 | RGD:62073 | Inparanoid, OMA, EggNOG |
| Dog | 448783 | P2RX4 | purinergic receptor P2X 4 | 9615 | VGNC:44210 | Inparanoid, OMA, EggNOG |
| Horse | 100059626 | P2RX4 | purinergic receptor P2X 4 | 9796 | VGNC:50960 | Inparanoid, OMA, EggNOG |
| Cow | 338036 | P2RX4 | purinergic receptor P2X 4 | 9913 | VGNC:32520 | Inparanoid, OMA, EggNOG |
| Opossum | 100618270 | P2RX4 | purinergic receptor P2X 4 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | P2RX4 | purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535] | 9258 | | OMA, EggNOG |
| Chicken | 374166 | P2RX4 | purinergic receptor P2X 4 | 9031 | CGNC:2857 | Inparanoid, OMA |
| Anole lizard | 100561452 | p2rx4 | purinergic receptor P2X 4 | 28377 | | Inparanoid, OMA |
| Xenopus | 100489363 | p2rx4 | purinergic receptor P2X, ligand gated ion channel, 4 | 8364 | XB-GENE-967965 | Inparanoid, OMA |
| Zebrafish | 259258 | p2rx4a | purinergic receptor P2X, ligand-gated ion channel, 4a | 7955 | ZDB-GENE-020806-2 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
