Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

P2RX7

DescriptionP2X purinoceptor 7

Gene and Protein Information

Gene ID5027
Uniprot Accession IDs A8K2Z0 E7EMK6 F5H6P2 F5H7E8 F8W951 O14991 Q4VKH8 Q4VKH9 Q4VKI0 Q4VKI1 Q4VKI2 Q4VKI3 Q4VKI4 Q7Z771 Q96EV7 P2X7
Ensembl ID ENSP00000330696
Symbol P2X7
FamilyBelongs to the P2X receptor family.
Sequence
MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque699455P2RX7purinergic receptor P2X 79544Inparanoid, OMA
Mouse18439P2rx7purinergic receptor P2X, ligand-gated ion channel, 710090MGI:1339957Inparanoid, OMA
Rat29665P2rx7purinergic receptor P2X 710116RGD:3241Inparanoid, OMA
Dog448778P2RX7purinergic receptor P2X 79615VGNC:44212Inparanoid, OMA
Horse100058464P2RX7purinergic receptor P2X 79796VGNC:21108Inparanoid, OMA
Cow286814P2RX7purinergic receptor P2X 79913VGNC:32522Inparanoid, OMA
PigP2RX7purinergic receptor P2X 7 [Source:HGNC Symbol;Acc:HGNC:8537]9823Inparanoid, OMA
Chicken771952P2RX7purinergic receptor P2X 79031CGNC:2831Inparanoid, OMA
Anole lizard100561255p2rx7purinergic receptor P2X 728377Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Ion channel    /    ATP-gated p2x receptor cation channel (p2x receptor) family    /    P2X purinoceptor 7

Associated Approved Drugs

    Associated Active Ligands

      Bibliography

      1.Gu, B J BJ and 7 more authors. 2001-04-06 A Glu-496 to Ala polymorphism leads to loss of function of the human P2X7 receptor. [PMID:11150303]
      2.Gartland, A A, Hipskind, R A RA, Gallagher, J A JA and Bowler, W B WB. 2001-05 Expression of a P2X7 receptor by a subpopulation of human osteoblasts. [PMID:11341329]
      3.Kim, M M, Jiang, L H LH, Wilson, H L HL, North, R A RA and Surprenant, A A. 2001-11-15 Proteomic and functional evidence for a P2X7 receptor signalling complex. [PMID:11707406]
      4.Worthington, R A RA and 6 more authors. 2002-02-13 Point mutations confer loss of ATP-induced human P2X(7) receptor function. [PMID:11852049]
      5.Wilson, Heather L HL, Wilson, Stuart A SA, Surprenant, Annmarie A and North, R Alan RA. 2002-09-13 Epithelial membrane proteins induce membrane blebbing and interact with the P2X7 receptor C terminus. [PMID:12107182]
      6.James, Greg G and Butt, Arthur M AM. 2002-07-05 P2Y and P2X purinoceptor mediated Ca2+ signalling in glial cell pathology in the central nervous system. [PMID:12151016]
      7. and North, R Alan RA. 2002-10 Molecular physiology of P2X receptors. [PMID:12270951]
      8.Li, Cheuk M CM and 7 more authors. 2002-11-15 Association of a polymorphism in the P2X7 gene with tuberculosis in a Gambian population. [PMID:12404161]
      9.Atkinson, Lucy L, Milligan, Carol J CJ, Buckley, Noel J NJ and Deuchars, Jim J. 2002-11-07 An ATP-gated ion channel at the cell nucleus. [PMID:12422208]
      10.Sluyter, Ronald R and Wiley, James S JS. 2002-12 Extracellular adenosine 5'-triphosphate induces a loss of CD23 from human dendritic cells via activation of P2X7 receptors. [PMID:12456589]