JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

P2Y purinoceptor 1

Gene ID	5028
uniprot	P47900
Gene Name	P2RY1
Ensernbl ID	ENSP00000304767
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	5028	P2RY1	P2Y purinoceptor 1	P47900
MOUSE	18441	P2ry1	Uncharacterized protein	Q8BMJ5
MOUSE		P2ry1	Purinergic receptor P2Y	A5JVP3
MOUSE	18441	P2ry1	Purinergic receptor P2Y, G-protein coupled 1	Q544J5
MOUSE	18441	P2ry1	P2Y purinoceptor 1	P49650
RAT	25265	P2ry1	P2Y purinoceptor 1	P49651

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Purinoceptor / P2Y receptor / P2y purinoceptor 1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx