The store will not work correctly when cookies are disabled.
P2RY1
| Description | P2Y purinoceptor 1 |
|---|
Gene and Protein Information
| Gene ID | 5028 |
|---|
| Uniprot Accession IDs | P2Y1 |
|---|
| Ensembl ID | ENSP00000304767 |
|---|
| Symbol | P2Y1 SARCC |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 470970 | P2RY1 | purinergic receptor P2Y1 | 9598 | VGNC:12119 | OMA, EggNOG |
| Macaque | 708507 | P2RY1 | purinergic receptor P2Y1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 18441 | P2ry1 | purinergic receptor P2Y, G-protein coupled 1 | 10090 | MGI:105049 | Inparanoid, OMA, EggNOG |
| Rat | 25265 | P2ry1 | purinergic receptor P2Y1 | 10116 | RGD:3242 | Inparanoid, OMA, EggNOG |
| Dog | 449621 | P2RY1 | purinergic receptor P2Y1 | 9615 | VGNC:44213 | Inparanoid, OMA, EggNOG |
| Horse | 100055494 | P2RY1 | purinergic receptor P2Y1 | 9796 | VGNC:21109 | Inparanoid, OMA, EggNOG |
| Cow | 281963 | P2RY1 | purinergic receptor P2Y1 | 9913 | VGNC:32523 | Inparanoid, OMA, EggNOG |
| Pig | 503666 | P2RY1 | purinergic receptor P2Y1 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100020509 | P2RY1 | purinergic receptor P2Y1 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100080337 | P2RY1 | purinergic receptor P2Y1 | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 396275 | P2RY1 | purinergic receptor P2Y1 | 9031 | CGNC:49730 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100558926 | p2ry1 | purinergic receptor P2Y1 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100124773 | p2ry1 | purinergic receptor P2Y, G-protein coupled, 1 | 8364 | XB-GENE-1000145 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
