The store will not work correctly when cookies are disabled.
P2RY6
| Description | P2Y purinoceptor 6 |
|---|
Gene and Protein Information
| Gene ID | 5031 |
|---|
| Uniprot Accession IDs | Q15754 P2Y6 |
|---|
| Ensembl ID | ENSP00000480966 |
|---|
| Symbol | P2Y6 |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 451410 | P2RY6 | pyrimidinergic receptor P2Y6 | 9598 | VGNC:7510 | OMA, EggNOG |
| Macaque | 718623 | P2RY6 | pyrimidinergic receptor P2Y6 | 9544 | | Inparanoid, OMA |
| Mouse | 233571 | P2ry6 | pyrimidinergic receptor P2Y, G-protein coupled, 6 | 10090 | MGI:2673874 | Inparanoid, OMA, EggNOG |
| Rat | 117264 | P2ry6 | pyrimidinergic receptor P2Y6 | 10116 | RGD:620269 | Inparanoid, OMA, EggNOG |
| Dog | 485202 | P2RY6 | pyrimidinergic receptor P2Y6 | 9615 | VGNC:44218 | Inparanoid, OMA, EggNOG |
| Cow | 539703 | P2RY6 | pyrimidinergic receptor P2Y6 | 9913 | VGNC:32530 | Inparanoid, OMA, EggNOG |
| Pig | 100512849 | P2RY6 | pyrimidinergic receptor P2Y6 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | | P2RY6 | pyrimidinergic receptor P2Y6 [Source:HGNC Symbol;Acc:HGNC:8543] | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 396114 | P2RY6 | pyrimidinergic receptor P2Y6 | 9031 | CGNC:13017 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552148 | p2ry6 | pyrimidinergic receptor P2Y6 | 28377 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
