Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Phospholipase A2, membrane associated

Gene ID5320
uniprotP14555
Gene NamePLA2G2A
Ensernbl IDENSP00000383364
FamilyBelongs to the phospholipase A2 family.
Sequence
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN5320PLA2G2APhospholipase A2, membrane associatedP14555
MOUSEPla2g2aPhospholipase A2 group IIaV5TCF4
MOUSEPla2g2aPhospholipase A(2)V5TDL3
MOUSEPla2g2aPhospholipase A(2)V5TE30
MOUSE18780Pla2g2aPhospholipase A(2)V5TDK8
MOUSEPla2g2aPhospholipase A(2)V5TE25
MOUSEPla2g2aPhospholipase A(2)S4R1F8
MOUSEPla2g2aPhospholipase A2 group IIaV5TCE8
MOUSEPla2g2aPhospholipase A(2)V5TBZ1
MOUSEPla2g2aPhospholipase A(2)V5TCT6
MOUSEPla2g2aPhospholipase A(2)V5TBZ5
MOUSE18780Pla2g2aPhospholipase A2, membrane associatedP31482
RATPla2g2aPhospholipase A2B6VNU2
RATPla2g2aPhospholipase A2B6VNU1
RAT29692Pla2g2aPhospholipase A2, membrane associatedP14423

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    phospholipase    /    Phospholipase A2, membrane associated
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Lipase    /    Phospholipase    /    Phospholipase A2, membrane associated

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source