The store will not work correctly when cookies are disabled.
Protein or Target Summary
Phospholipase A2, membrane associated
Gene ID | 5320 |
uniprot | P14555 |
Gene Name | PLA2G2A |
Ensernbl ID | ENSP00000383364 |
Family | Belongs to the phospholipase A2 family. |
Sequence | MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 5320 | PLA2G2A | Phospholipase A2, membrane associated | P14555 |
MOUSE | | Pla2g2a | Phospholipase A2 group IIa | V5TCF4 |
MOUSE | | Pla2g2a | Phospholipase A(2) | V5TDL3 |
MOUSE | | Pla2g2a | Phospholipase A(2) | V5TE30 |
MOUSE | 18780 | Pla2g2a | Phospholipase A(2) | V5TDK8 |
MOUSE | | Pla2g2a | Phospholipase A(2) | V5TE25 |
MOUSE | | Pla2g2a | Phospholipase A(2) | S4R1F8 |
MOUSE | | Pla2g2a | Phospholipase A2 group IIa | V5TCE8 |
MOUSE | | Pla2g2a | Phospholipase A(2) | V5TBZ1 |
MOUSE | | Pla2g2a | Phospholipase A(2) | V5TCT6 |
MOUSE | | Pla2g2a | Phospholipase A(2) | V5TBZ5 |
MOUSE | 18780 | Pla2g2a | Phospholipase A2, membrane associated | P31482 |
RAT | | Pla2g2a | Phospholipase A2 | B6VNU2 |
RAT | | Pla2g2a | Phospholipase A2 | B6VNU1 |
RAT | 29692 | Pla2g2a | Phospholipase A2, membrane associated | P14423 |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|