PLA2G5

DescriptionCalcium-dependent phospholipase A2

Gene and Protein Information

Gene ID5322
Uniprot Accession IDs Q8N435
Ensembl ID ENSP00000364249
Symbol FRFB GV-PLA2 PLA2-10 hVPLA(2)
FamilyBelongs to the phospholipase A2 family.
Sequence
MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp456588PLA2G5phospholipase A2 group V9598VGNC:9883OMA, EggNOG
Mouse18784Pla2g5phospholipase A2, group V10090MGI:101899Inparanoid, OMA, EggNOG
Rat29354Pla2g5phospholipase A2, group V10116RGD:62051Inparanoid, OMA, EggNOG
Dog478207PLA2G5phospholipase A2 group V9615VGNC:44630Inparanoid, OMA, EggNOG
Horse100058536PLA2G5phospholipase A2 group V9796VGNC:21517Inparanoid, OMA, EggNOG
Cow614911PLA2G5phospholipase A2 group V9913VGNC:32963Inparanoid, OMA, EggNOG
Chicken771655PLA2G5phospholipase A2 group V9031CGNC:56947OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    phospholipase    /    Calcium-dependent phospholipase A2
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Lipase    /    Phospholipase    /    Calcium-dependent phospholipase A2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source