JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

High affinity immunoglobulin epsilon receptor subunit beta

Gene ID	2206
uniprot	Q01362
Gene Name	MS4A2
Ensernbl ID	ENSP00000278888
Family	Belongs to the MS4A family.
Sequence	MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	2206	MS4A2	High affinity immunoglobulin epsilon receptor subunit beta	Q01362
MOUSE	14126	Ms4a2	High affinity immunoglobulin epsilon receptor subunit beta	A0A0B4J1P0
MOUSE	14126	Ms4a2	High affinity immunoglobulin epsilon receptor subunit beta	A0A087WPM9
MOUSE	14126	Ms4a2	Membrane-spanning 4-domains, subfamily A, member 2	B2RTF7
MOUSE	14126	Ms4a2	High affinity immunoglobulin epsilon receptor subunit beta	Q3UNT6
MOUSE	14126	Ms4a2	High affinity immunoglobulin epsilon receptor subunit beta	P20490
RAT		Ms4a2	High affinity immunoglobulin epsilon receptor subunit beta	A0A0H2UHS6
RAT	25316	Ms4a2	High affinity immunoglobulin epsilon receptor subunit beta	P13386

Protein Classes

PANTHER Classes
protein / receptor / High affinity immunoglobulin epsilon receptor subunit beta

DTO Classes
protein / Receptor / High affinity immunoglobulin epsilon receptor subunit beta

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx