Protein or Target Summary

Organic solute transporter subunit alpha

Gene ID	200931
uniprot	Q86UW1
Gene Name	SLC51A
Ensernbl ID	ENSP00000296327
Family	Belongs to the OST-alpha family.
Sequence	MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGPVELALTSILTLLALGSIAIFLEDAVYLYKNTLCPIKRRTLLWKSSAPTVVSVLCCFGLWIPRSLVLVEMTITSFYAVCFYLLMLVMVEGFGGKEAVLRTLRDTPMMVHTGPCCCCCPCCPRLLLTRKKLQLLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVSTLLALWTLGIISRQARLHLGEQNMGAKFALFQVLLILTALQPSIFSVLANGGQIACSPPYSSKTRSQVMNCHLLILETFLMTVLTRMYYRRKDHKVGYETFSSPDLDLNLKA Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	200931	SLC51A	Organic solute transporter subunit alpha	Q86UW1
MOUSE		Slc51a	Organic solute transporter subunit alpha	A0A338P6E4
MOUSE	106407	Slc51a	Organic solute transporter subunit alpha	Q8R000
RAT	303879	Slc51a	Similar to RIKEN cDNA D630035O19 (Predicted), isoform CRA_b	D4AC81

Protein Classes

PANTHER Classes
protein / transporter / Organic solute transporter subunit alpha

DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC51 family of steroid-derived molecule transporters / Organic solute transporter subunit alpha

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx