The store will not work correctly when cookies are disabled.
PAFAH1B2
Description | Platelet-activating factor acetylhydrolase IB subunit beta |
---|
Gene and Protein Information
Gene ID | 5049 |
Uniprot Accession IDs | A8DPS5 A8DPS6 A8DPS7 E9PEJ5 E9PLP3 O00687 Q29459 Q6IBR6 |
Ensembl ID | ENSP00000435289 |
Symbol | PAFAHB HEL-S-303 |
Family | Belongs to the 'GDSL' lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily. |
Sequence | MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 451567 | PAFAH1B2 | platelet activating factor acetylhydrolase 1b catalytic subunit 2 | 9598 | VGNC:3239 | OMA, EggNOG |
Macaque | 703013 | PAFAH1B2 | platelet activating factor acetylhydrolase 1b catalytic subunit 2 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 18475 | Pafah1b2 | platelet-activating factor acetylhydrolase, isoform 1b, subunit 2 | 10090 | MGI:108415 | Inparanoid, OMA, EggNOG |
Rat | 64189 | Pafah1b2 | platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 | 10116 | RGD:620332 | Inparanoid, OMA |
Dog | | PAFAH1B2 | platelet activating factor acetylhydrolase 1b catalytic subunit 2 [Source:HGNC Symbol;Acc:HGNC:8575] | 9615 | | OMA, EggNOG |
Horse | 100062620 | PAFAH1B2 | platelet activating factor acetylhydrolase 1b catalytic subunit 2 | 9796 | VGNC:21133 | Inparanoid, OMA |
Cow | 282514 | PAFAH1B2 | platelet activating factor acetylhydrolase 1b catalytic subunit 2 | 9913 | VGNC:32550 | Inparanoid, OMA |
Opossum | | PAFAH1B2 | platelet activating factor acetylhydrolase 1b catalytic subunit 2 [Source:HGNC Symbol;Acc:HGNC:8575] | 13616 | | Inparanoid, OMA |
Platypus | 100083728 | PAFAH1B2 | platelet activating factor acetylhydrolase 1b catalytic subunit 2 | 9258 | | Inparanoid, OMA, EggNOG |
Chicken | 419765 | PAFAH1B2 | platelet activating factor acetylhydrolase 1b catalytic subunit 2 | 9031 | CGNC:66351 | Inparanoid, OMA |
Xenopus | 100492775 | pafah1b2 | platelet activating factor acetylhydrolase 1b catalytic subunit 2 | 8364 | XB-GENE-962580 | Inparanoid, OMA, EggNOG |
Zebrafish | 567170 | pafah1b2 | platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 | 7955 | ZDB-GENE-060526-43 | Inparanoid, OMA |
Fruitfly | 32529 | Paf-AHalpha | Platelet-activating factor acetylhydrolase alpha | 7227 | FBgn0025809 | OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|