JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Platelet-activating factor acetylhydrolase IB subunit beta

Gene ID	5049
uniprot	P68402
Gene Name	PAFAH1B2
Ensernbl ID	ENSP00000435289
Family	Belongs to the 'GDSL' lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily.
Sequence	MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	5049	PAFAH1B2	Platelet-activating factor acetylhydrolase IB subunit beta	P68402
MOUSE		Pafah1b2	Platelet-activating factor acetylhydrolase IB subunit beta	A0A1L1SQ76
MOUSE		Pafah1b2	Platelet-activating factor acetylhydrolase IB subunit beta	A0A1L1SQV7
MOUSE		Pafah1b2	Platelet-activating factor acetylhydrolase IB subunit beta	A0A1L1SRD0
MOUSE		Pafah1b2	Platelet-activating factor acetylhydrolase IB subunit beta	A0A1L1SSQ5
MOUSE		Pafah1b2	Platelet-activating factor acetylhydrolase IB subunit beta	A0A1L1SVK0
MOUSE		Pafah1b2	Platelet-activating factor acetylhydrolase IB subunit beta	A0A1L1SSP3
MOUSE		Pafah1b2	Uncharacterized protein	Q8BTA2
MOUSE	18475	Pafah1b2	Platelet-activating factor acetylhydrolase IB subunit beta	Q61206
RAT	64189	Pafah1b2	Platelet-activating factor acetylhydrolase IB subunit beta	O35264

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx