The store will not work correctly when cookies are disabled.
CDCA5
Gene and Protein Information
| Gene ID | 113130 |
|---|
| Uniprot Accession IDs | A8K625 |
|---|
| Ensembl ID | ENSP00000275517 |
|---|
| Symbol | SORORIN |
|---|
| Family | Belongs to the sororin family. |
|---|
| Sequence | MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 451310 | CDCA5 | cell division cycle associated 5 | 9598 | VGNC:11291 | OMA, EggNOG |
| Macaque | 721998 | CDCA5 | cell division cycle associated 5 | 9544 | | Inparanoid, EggNOG |
| Mouse | 67849 | Cdca5 | cell division cycle associated 5 | 10090 | MGI:1915099 | Inparanoid, OMA, EggNOG |
| Rat | 684771 | Cdca5 | cell division cycle associated 5 | 10116 | RGD:1560863 | Inparanoid, EggNOG |
| Dog | 612071 | CDCA5 | cell division cycle associated 5 | 9615 | VGNC:39015 | Inparanoid, OMA, EggNOG |
| Horse | 100050887 | CDCA5 | cell division cycle associated 5 | 9796 | VGNC:16311 | Inparanoid, OMA, EggNOG |
| Cow | 613318 | CDCA5 | cell division cycle associated 5 | 9913 | | Inparanoid, EggNOG |
| Xenopus | 100145078 | cdca5 | cell division cycle associated 5 | 8364 | XB-GENE-5908127 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
