Protein or Target Summary

Diphosphoinositol polyphosphate phosphohydrolase 1

Gene ID	11165
uniprot	O95989
Gene Name	NUDT3
Ensernbl ID	ENSP00000476119
Family	Belongs to the Nudix hydrolase family. DIPP subfamily.
Sequence	MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	11165	NUDT3	Diphosphoinositol polyphosphate phosphohydrolase 1	O95989
MOUSE		Nudt3	Diphosphoinositol polyphosphate phosphohydrolase 1	H3BLR8
MOUSE		Nudt3	Diphosphoinositol polyphosphate phosphohydrolase 1	A0A338P7L3
MOUSE	56409	Nudt3	Diphosphoinositol polyphosphate phosphohydrolase 1	B2KF67
MOUSE		Nudt3	Diphosphoinositol polyphosphate phosphohydrolase 1	H3BJY4
MOUSE		Nudt3	Diphosphoinositol polyphosphate phosphohydrolase 1	A0A338P6L9
MOUSE		Nudt3	Diphosphoinositol polyphosphate phosphohydrolase 1	A0A338P6T6
MOUSE		Nudt3	Diphosphoinositol polyphosphate phosphohydrolase 1	I1E4X7
MOUSE	56409	Nudt3	Diphosphoinositol polyphosphate phosphohydrolase 1	Q9JI46
RAT	294292	Nudt3	Diphosphoinositol polyphosphate phosphohydrolase 1	Q566C7

Protein Classes

PANTHER Classes
protein / hydrolase / Diphosphoinositol polyphosphate phosphohydrolase 1
protein / phosphatase / Diphosphoinositol polyphosphate phosphohydrolase 1

DTO Classes
protein / Enzyme / Hydrolase / Phosphatase / Diphosphoinositol polyphosphate phosphohydrolase 1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx