The store will not work correctly when cookies are disabled.
P2RY10
| Description | Putative P2Y purinoceptor 10 |
|---|
Gene and Protein Information
| Gene ID | 27334 |
|---|
| Uniprot Accession IDs | D3DTE5 Q4VBN7 Q86V16 P2Y10 |
|---|
| Ensembl ID | ENSP00000171757 |
|---|
| Symbol | P2Y10 LYPSR2 |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 78826 | P2ry10 | purinergic receptor P2Y, G-protein coupled 10 | 10090 | MGI:1926076 | Inparanoid, OMA |
| Rat | 317219 | P2ry10 | P2Y receptor family member 10 | 10116 | RGD:1561912 | Inparanoid, OMA, EggNOG |
| Dog | 491980 | P2RY10 | P2Y receptor family member 10 | 9615 | VGNC:49748 | Inparanoid, OMA, EggNOG |
| Horse | 100072611 | LOC100072611 | putative P2Y purinoceptor 10 | 9796 | | OMA, EggNOG |
| Cow | 515172 | P2RY10 | P2Y receptor family member 10 | 9913 | VGNC:32524 | Inparanoid, OMA, EggNOG |
| Pig | 100157702 | P2RY10 | P2Y receptor family member 10 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100020339 | LOC100020339 | putative P2Y purinoceptor 10 | 13616 | | OMA, EggNOG |
| Chicken | 422147 | P2RY10 | purinergic receptor P2Y10 | 9031 | CGNC:51633 | OMA, EggNOG |
| Anole lizard | 100562253 | LOC100562253 | putative P2Y purinoceptor 10 | 28377 | | OMA, EggNOG |
| Xenopus | 100495529 | p2ry10 | P2Y receptor family member 10 | 8364 | XB-GENE-967610 | Inparanoid, OMA, EggNOG |
| Zebrafish | 100037375 | p2ry10 | P2Y receptor family member 10 | 7955 | ZDB-GENE-070410-105 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
