JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

P2RY10

Description	Putative P2Y purinoceptor 10

Gene and Protein Information

Gene ID	27334
Uniprot Accession IDs	D3DTE5 Q4VBN7 Q86V16 P2Y10
Ensembl ID	ENSP00000171757
Symbol	P2Y10 LYPSR2
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	78826	P2ry10	purinergic receptor P2Y, G-protein coupled 10	10090	MGI:1926076	Inparanoid, OMA
Rat	317219	P2ry10	P2Y receptor family member 10	10116	RGD:1561912	Inparanoid, OMA, EggNOG
Dog	491980	P2RY10	P2Y receptor family member 10	9615	VGNC:49748	Inparanoid, OMA, EggNOG
Horse	100072611	LOC100072611	putative P2Y purinoceptor 10	9796		OMA, EggNOG
Cow	515172	P2RY10	P2Y receptor family member 10	9913	VGNC:32524	Inparanoid, OMA, EggNOG
Pig	100157702	P2RY10	P2Y receptor family member 10	9823		Inparanoid, OMA, EggNOG
Opossum	100020339	LOC100020339	putative P2Y purinoceptor 10	13616		OMA, EggNOG
Chicken	422147	P2RY10	purinergic receptor P2Y10	9031	CGNC:51633	OMA, EggNOG
Anole lizard	100562253	LOC100562253	putative P2Y purinoceptor 10	28377		OMA, EggNOG
Xenopus	100495529	p2ry10	P2Y receptor family member 10	8364	XB-GENE-967610	Inparanoid, OMA, EggNOG
Zebrafish	100037375	p2ry10	P2Y receptor family member 10	7955	ZDB-GENE-070410-105	Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Purinoceptor / P2Y receptor / Putative P2Y purinoceptor 10

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]