JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

NUDT7

Description	Peroxisomal coenzyme A diphosphatase NUDT7

Gene and Protein Information

Gene ID	283927
Uniprot Accession IDs	B4DLE5 H3BUB8
Ensembl ID	ENSP00000268533
Family	Belongs to the Nudix hydrolase family. PCD1 subfamily.
Sequence	MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTFEVQFNLNDVLASSEELFLKVHKKATSRL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	454256	NUDT7	nudix hydrolase 7	9598	VGNC:5858	OMA, EggNOG
Macaque	715443	NUDT7	nudix hydrolase 7	9544		Inparanoid, OMA, EggNOG
Mouse	67528	Nudt7	nudix (nucleoside diphosphate linked moiety X)-type motif 7	10090	MGI:1914778	Inparanoid, OMA, EggNOG
Rat	361413	Nudt7	nudix hydrolase 7	10116	RGD:1306719	Inparanoid, OMA, EggNOG
Dog	489703	NUDT7	nudix hydrolase 7	9615	VGNC:44035	Inparanoid, OMA, EggNOG
Horse	100069343	NUDT7	nudix hydrolase 7	9796	VGNC:20951	Inparanoid, OMA, EggNOG
Cow	504826	NUDT7	nudix hydrolase 7	9913	VGNC:32341	Inparanoid, OMA, EggNOG
Opossum	100014208	NUDT7	nudix hydrolase 7	13616		Inparanoid, EggNOG
Anole lizard	100555561	nudt7	nudix hydrolase 7	28377		Inparanoid, OMA, EggNOG
Xenopus		nudt7	nudix hydrolase 7 [Source:Xenbase;Acc:XB-GENE-966296]	8364		OMA, EggNOG
Zebrafish	100329471	nudt7	nudix (nucleoside diphosphate linked moiety X)-type motif 7	7955	ZDB-GENE-131127-212	OMA, EggNOG
C. elegans	190780	ndx-8	Peroxisomal coenzyme A diphosphatase ndx-8	6239		Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein / hydrolase / Peroxisomal coenzyme A diphosphatase NUDT7
protein / phosphatase / Peroxisomal coenzyme A diphosphatase NUDT7

DTO Classes
protein / Enzyme / Hydrolase / Phosphatase / Peroxisomal coenzyme A diphosphatase NUDT7

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]