Protein or Target Summary
Peroxisomal coenzyme A diphosphatase NUDT7
| Gene ID | 283927 |
|---|---|
| uniprot | P0C024 |
| Gene Name | NUDT7 |
| Ensernbl ID | ENSP00000268533 |
| Family | Belongs to the Nudix hydrolase family. PCD1 subfamily. |
| Sequence | MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTFEVQFNLNDVLASSEELFLKVHKKATSRL Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 283927 | NUDT7 | Peroxisomal coenzyme A diphosphatase NUDT7 | P0C024 |
| MOUSE | 67528 | Nudt7 | Peroxisomal coenzyme A diphosphatase NUDT7 | Q99P30 |
| RAT | Nudt7 | Nudix hydrolase 7 | A0A1W2Q6B7 | |
| RAT | Nudt7 | Nudix (Nucleoside diphosphate linked moiety X)-type motif 7 (Predicted), isoform CRA_d | D3ZV74 | |
| RAT | Nudt7 | Nudix hydrolase 7 | A0A1W2Q618 | |
| RAT | Nudt7 | Nudix hydrolase 7 | A0A1W2Q6F7 |
Protein Classes
PANTHER Classes
protein / hydrolase / Peroxisomal coenzyme A diphosphatase NUDT7
protein / phosphatase / Peroxisomal coenzyme A diphosphatase NUDT7
protein / hydrolase / Peroxisomal coenzyme A diphosphatase NUDT7
protein / phosphatase / Peroxisomal coenzyme A diphosphatase NUDT7
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx