The store will not work correctly when cookies are disabled.
Protein or Target Summary
Low molecular weight phosphotyrosine protein phosphatase
| Gene ID | 52 |
|---|
| uniprot | P24666 |
|---|
| Gene Name | ACP1 |
|---|
| Ensernbl ID | ENSP00000272067 |
|---|
| Family | Belongs to the low molecular weight phosphotyrosine protein phosphatase family. |
|---|
| Sequence | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 52 | ACP1 | Low molecular weight phosphotyrosine protein phosphatase | P24666 |
| MOUSE | | Acp1 | Low molecular weight phosphotyrosine protein phosphatase | A0A1W2P7X3 |
| MOUSE | 11431 | Acp1 | Acid phosphatase 1, soluble | Q4VAI2 |
| MOUSE | 11431 | Acp1 | Acp1 protein | Q561M1 |
| MOUSE | 11431 | Acp1 | Low molecular weight phosphotyrosine protein phosphatase | Q9D358 |
| RAT | | Acp1 | Low molecular weight phosphotyrosine protein phosphatase | Z4YNF4 |
| RAT | | Acp1 | Low molecular weight phosphotyrosine protein phosphatase | A0A0G2K394 |
| RAT | 24161 | Acp1 | Acp1 protein | B0BNC1 |
| RAT | 24161 | Acp1 | Low molecular weight phosphotyrosine protein phosphatase | P41498 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
