The store will not work correctly when cookies are disabled.
ACP1
Description | Low molecular weight phosphotyrosine protein phosphatase |
---|
Gene and Protein Information
Gene ID | 52 |
Uniprot Accession IDs | A8K1L9 B5MCC7 P24667 Q16035 Q16036 Q16725 Q3KQX8 Q53RU0 LMW-PTP |
Ensembl ID | ENSP00000272067 |
Symbol | HAAP LMWPTP LMW-PTP |
Family | Belongs to the low molecular weight phosphotyrosine protein phosphatase family. |
Sequence | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 458990 | ACP1 | acid phosphatase 1 | 9598 | VGNC:48983 | OMA, EggNOG |
Mouse | 11431 | Acp1 | acid phosphatase 1, soluble | 10090 | MGI:87881 | Inparanoid, OMA, EggNOG |
Rat | 24161 | Acp1 | acid phosphatase 1 | 10116 | RGD:2020 | Inparanoid, OMA, EggNOG |
Horse | 100057408 | ACP1 | acid phosphatase 1 | 9796 | VGNC:51272 | Inparanoid, EggNOG |
Cow | 280977 | ACP1 | acid phosphatase 1 | 9913 | | Inparanoid, OMA, EggNOG |
Pig | 100737301 | ACP1 | acid phosphatase 1 | 9823 | | Inparanoid, OMA, EggNOG |
Platypus | 100080893 | ACP1 | acid phosphatase 1 | 9258 | | Inparanoid, EggNOG |
Chicken | 421909 | ACP1 | acid phosphatase 1, soluble | 9031 | CGNC:12245 | Inparanoid, EggNOG |
Anole lizard | 100565351 | acp1 | acid phosphatase 1 | 28377 | | Inparanoid, EggNOG |
Xenopus | 448657 | acp1 | acid phosphatase 1 | 8364 | XB-GENE-973004 | Inparanoid, OMA, EggNOG |
Zebrafish | 541489 | acp1 | acid phosphatase 1 | 7955 | ZDB-GENE-050327-12 | Inparanoid, EggNOG |
C. elegans | 177055 | Y94H6A.7 | Uncharacterized protein | 6239 | | OMA, EggNOG |
S.cerevisiae | 856187 | LTP1 | tyrosine protein phosphatase LTP1 | 4932 | S000006277 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|